KEGG   Aethina tumida (small hive beetle): 109595878
Entry
109595878         CDS       T06105                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: epidermal growth factor receptor
  KO
K04361  epidermal growth factor receptor [EC:2.7.10.1]
Organism
atd  Aethina tumida (small hive beetle)
Pathway
atd04013  MAPK signaling pathway - fly
atd04068  FoxO signaling pathway
atd04144  Endocytosis
atd04214  Apoptosis - fly
atd04320  Dorso-ventral axis formation
Brite
KEGG Orthology (KO) [BR:atd00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    109595878
   04068 FoxO signaling pathway
    109595878
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    109595878
  09143 Cell growth and death
   04214 Apoptosis - fly
    109595878
 09150 Organismal Systems
  09158 Development and regeneration
   04320 Dorso-ventral axis formation
    109595878
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:atd01001]
    109595878
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:atd04147]
    109595878
Enzymes [BR:atd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     109595878
Protein kinases [BR:atd01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   109595878
Exosome [BR:atd04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   109595878
  Exosomal proteins of pancreatic cancer cells
   109595878
  Exosomal proteins of bladder cancer cells
   109595878
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain Pkinase GF_recep_IV Furin-like Kinase-like APH
Other DBs
NCBI-GeneID: 109595878
NCBI-ProteinID: XP_019866868
LinkDB
Position
Unknown
AA seq 1210 aa
MDFTHIFGISLLLALVQAQSGLIEERVCIGTNGRMSVPSNRDHHYRNLKDRYTNCTYVDG
NLELTWLQDENLDLSFLQYIREVTGYVLISHVDIKRIVLPRLQIIRGRTLFRMNTRGEDF
SLIITLSKMFTIELPSLRDILNGNVGVFNNYNLCHVKTIDWNEIITGNNANYSYTYSFSS
PERNCPACHESCERGCWGEGEENCQKFSKVTCSPQCYKGRCYGSNPRECCHLFCAGGCTG
PKQSDCIACKNFYDDGVCTQECPPMQMYNPTTYSWQPNPKGKYAYGATCVKNCPEHLLKD
SGACVRTCPPNKKAENGECIPCDGPCPKTCPGNVVVDSGNIDKFKGCTIIEGYISILEIT
FKGYQDIYPNFTFGERHEKMHPDRLEVFSSLKEITGYLDIEGYDKDFKNLSYFRNLEVIG
GRTLFEYLSSLYIVKTSLESLELKSLKKINTGTISILENKHLCFADTIKWDKIKKKDHPL
LLANNSDPLTCQNRGLVCDEQCSKDGCWGPGPDQCLSCANFKYGNRCIQNCTVIPGIYRA
DNKECKPCHEQCGSYCTGPGREHCDACKNFRDGPYCVESCPTNKYNNSGICEQCPSICID
GCTGPNPTVGLGGCRSCHLAVLNLNGTVNNCLYKNDSCPDGYYMELVTSQTQEHLIPLMG
KNICRKCHPRCKKCTSYGFHTSVCQQCTLYKKGEQCEDECTPDFYPDDKRRECMPCDSEC
RGCTGPGPENCISCQNLKLYDDQSDTNSSSFKCISTCPPEFPHRHFPENAEPFCSEINVS
ASPVIAKRNDIWYIVIGIIVSVFCIATCVACFWVYIVKQRETESTMKMTMALTGLDDNEP
LRPSNVAPNVAKLRIIKETEIRKGNILGLGAFGTVYKGVWILENENAKIPVAIKVLREDT
GANTSKEFLGEAYIMASVDHPNLLQLLAVCMTSQMMLITQLMPLGCLLDFVRKNKDKITS
KALLTWSTQIARGMAYLEEKRLVHRDLAARNVLVQSPACVKITDFGLAKLLDINEEEYKA
AGGKMPIKWLALECIQHRIFTHKSDVWAFGVTIWELLTFGGRPYENVLARDVPELLEKGE
RLPQPSIASIDVYMIMIKCWMLDAESRPCFKELEDDFSKMSRDPGRYLAIPGDKYMRHHF
PTKPDKDIKNLAVNLDTSESMSEGDEYLQSKSRVPIQQSGMSSTSSMSIQPNSGRCWPHD
TSDPSRSWPP
NT seq 3633 nt   +upstreamnt  +downstreamnt
atggatttcacgcacatattcgggatatccctgctgctcgcccttgtccaggctcaatcg
ggattaatcgaggaaagagtttgtatcggtactaatgggcgcatgtcggtaccttccaac
cgagatcaccactacagaaacttgaaggaccgctacacaaactgcacatatgtggacgga
aacctggaactcacctggttgcaggatgaaaatttggatctgagctttttgcagtacatc
cgcgaagtaaccggttacgtgctcatctcccatgtggacatcaagcggatcgtgttgccg
cgtttgcaaatcatccgtggacggaccttgttcagaatgaacactcgcggggaagatttc
tcattgattataaccctgtcaaaaatgttcacgattgagcttccctccctccgtgacatc
ttaaatggaaacgtgggcgtatttaacaactacaatctttgtcacgtgaagaccatcgac
tggaatgaaataataacaggaaacaacgctaattatagctatacttactccttcagttcc
cccgaaagaaactgccccgcttgccacgaaagctgcgaaagaggctgttggggcgagggt
gaggagaactgtcagaagttctcgaaggtgacctgcagcccgcagtgctacaaaggaaga
tgctacggatcgaatccacgagaatgttgccatttattctgtgccggtggctgtaccgga
ccgaaacaaagcgactgcatagcgtgcaagaatttttacgatgacggtgtttgcacacaa
gagtgtccccccatgcaaatgtacaatccaactacgtactcctggcaaccgaatcccaaa
gggaaatatgcttatggagccacgtgtgtgaaaaattgcccggaacatttgctaaaggac
agtggggcttgtgtcaggacgtgtccacccaataaaaaagctgaaaatggtgaatgcatt
ccatgtgacggaccttgcccaaagacttgtcccggaaatgttgtcgtagactctggaaac
attgataaatttaaaggttgcaccattattgaaggatacattagcattttggaaatcacc
ttcaaaggatatcaggacatctaccccaatttcactttcggtgaacggcacgaaaagatg
catccagataggctggaagtgttcagttctttgaaagaaattaccgggtaccttgatata
gagggctacgacaaagatttcaaaaacctttcctactttagaaatctcgaagttattggc
ggtcgaactttatttgaatacttgtcatctttgtacatcgtgaagacttctttagagtcg
ttggaattaaagtcacttaagaaaatcaatacgggaaccattagcatattagaaaacaaa
cacttgtgctttgcggacactattaaatgggacaaaatcaagaaaaaggaccatccactt
cttttggctaataatagtgaccctctaacgtgtcaaaacagaggactagtgtgcgatgaa
cagtgtagcaaagacggatgttggggacctggaccagatcaatgtctctcttgtgcaaac
tttaaatatggcaacagatgcatccagaattgcaccgtaataccaggaatataccgtgca
gacaacaaggaatgcaaaccgtgtcatgaacaatgtggttcatattgtactggtcccggc
cgagaacactgtgatgcctgcaaaaacttcagagatggcccatattgcgtagaaagttgc
cctactaacaaatacaacaacagtggtatatgtgaacaatgtccctctatttgtattgat
ggatgcactggtcccaatcctactgttggtttgggaggatgtcgttcttgtcaccttgca
gttctgaatctcaatggaacagtcaacaattgtctttacaagaatgattcttgtcctgat
ggatactatatggaactggtgacctcccagactcaagaacatttgataccactaatggga
aagaacatatgcagaaagtgtcatccaaggtgcaaaaaatgtacaagttatggcttccat
acgtctgtatgccaacaatgcaccctgtacaagaaaggagaacagtgtgaggatgagtgt
acgccagacttttaccccgacgataaacgtcgggagtgtatgccatgtgacagtgaatgc
cgaggatgcaccggaccaggaccggaaaactgcatatcttgccaaaaccttaagctgtac
gacgaccaaagtgataccaacagcagttcctttaaatgtatttctacttgcccgccggaa
tttcctcacagacatttccctgaaaacgccgaaccgttttgttcagaaatcaacgtatct
gcatcgccagtaattgctaagaggaacgatatttggtatatagtaataggaataattgtg
tcagtgttttgtattgcaacatgtgtagcatgtttctgggtatacatagtaaagcaaagg
gaaactgaaagcaccatgaaaatgactatggcattaactggcttggacgataatgaaccc
ttacgaccaagcaacgtggcaccaaacgttgctaaattgagaattataaaagaaaccgaa
ataaggaaaggcaatattctcgggttgggtgctttcggtactgtctacaaaggagtgtgg
attttagaaaatgaaaatgctaaaattcctgttgctattaaagtacttagagaagacact
ggagctaacacaagcaaggagttcttgggagaagcttatataatggctagcgttgatcat
cctaatttactacaacttctagcagtatgtatgacgtcacaaatgatgctgatcacgcaa
ctcatgcctttgggttgtttgcttgattttgtcagaaaaaataaagataaaattacctct
aaagcattacttacttggtctacacaaattgcgaggggtatggcatatttagaagaaaaa
cgtctggttcacagagacttagctgctagaaatgttttagtgcaatcaccggcttgtgta
aagattacagattttggtttggccaaacttctcgacattaacgaagaagaatataaggct
gcaggtggaaaaatgcccatcaaatggttagctttggaatgcattcagcacaggatattt
actcacaaatctgacgtgtgggctttcggagtcactatttgggagttgcttacctttgga
ggacgtccttacgaaaatgtacttgccagagacgtgcctgaattacttgaaaaaggcgaa
cgattaccccaaccatccatagcgagcattgatgtttatatgataatgataaaatgttgg
atgctcgatgccgaaagtaggccatgcttcaaagaacttgaagatgatttttctaaaatg
tcaagagacccaggaagatatttagctattccaggagacaaatacatgagacatcatttt
cctacaaagcctgacaaagatattaaaaatttggcagtcaatctggatacatccgagtcc
atgtctgaaggagacgaatatctccagtcaaagtcaagggtcccaattcaacagtccgga
atgtcatcaacttcttcaatgagtattcagcccaattctggtagatgttggccacatgac
acctctgatcctagtagatcttggcccccataa

DBGET integrated database retrieval system