KEGG   Aethina tumida (small hive beetle): 109596596
Entry
109596596         CDS       T06105                                 

Definition
(RefSeq) NAD-dependent protein deacetylase sirtuin-1
  KO
K11411  NAD+-dependent protein deacetylase sirtuin 1 [EC:2.3.1.286]
Organism
atd  Aethina tumida (small hive beetle)
Pathway
atd00760  Nicotinate and nicotinamide metabolism
atd01100  Metabolic pathways
atd04068  FoxO signaling pathway
atd04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:atd00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    109596596
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    109596596
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    109596596
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:atd03036]
    109596596
   03029 Mitochondrial biogenesis [BR:atd03029]
    109596596
Enzymes [BR:atd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.286  protein acetyllysine N-acetyltransferase
     109596596
Chromosome and associated proteins [BR:atd03036]
 Eukaryotic type
  Histone modification proteins
   HDACs (histone deacetylases)
    SIRTs (sirtuins, class III HDACs)
     109596596
Mitochondrial biogenesis [BR:atd03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    109596596
SSDB
Motif
Pfam: SIR2 DUF592 TPP_enzyme_M
Other DBs
NCBI-GeneID: 109596596
NCBI-ProteinID: XP_019867719
LinkDB
Position
Unknown
AA seq 695 aa
MDSYPDVVEHESSAKRIKLDLGDSNIGELCNRRGFPCFSTSIPGAMDISEGISADCDSGY
EASTLESLPTPSHHPSPHTEHGDTRESLSVSDSLQQTPTYTGDQLDTSQDSLEIDDDNAS
TVSHLSDLSGLSELSGQDWKPMAGSMIWIQKQMAHGVNPRMILSDLGVELDQIPQYVDEV
TLWKLIINMLAEPPRRNKLRHVNTLDDVVRLLRGAQKIIVLTGAGVSVSCGIPDFRSRDG
IYSRLAIDFPNLPDPQAMFDISYFSQDPRPFYKFARDIYPGKFQPSPCHRFIKLLEKHKK
LLRNYTQNIDTLEKEANIERVIECHGSFATATCTKCGHKVTANNIRETVLAQKIPLCEVC
HAGEESSVSTDDLGEERDYRGLVASGIMKPDIVFFGEGLPDTFHEAMSADKTECDLLLVI
GSSLKVRPVALIPSSLPAHIPQILINREPLHHCRFDVELLGDCDVIINHLCQLLGNSWEE
GIYSTDVLKESPLLPVPNPLRPYENRTETEPNYTVDMPETEKEFSCECNSSTNASSFNIE
KNVDVSCSCSHAQMSISQDDFDDLKQTKERHMSIDSARDSGIGDNSNFTDLETKYDDTSD
DNKDESDVEPKVYPTSKTESNGESSNTELRGLWQPKIKKSLADRLPPNSYHIIPPSRYIF
PGAEVFYDPDDGCPQKTESSTSSSDSDSDSEDINI
NT seq 2088 nt   +upstreamnt  +downstreamnt
atggattcctatcctgacgttgtcgaacatgaatccagtgcaaaaagaataaaactagat
ttaggcgactctaatataggtgaattgtgcaacagaagaggttttccctgtttttccaca
tcaattccgggcgcgatggacatctcagaaggtatatccgcagactgcgattctggttat
gaagcatcgacactcgaatcgctacccacaccctcacatcacccttcaccacacaccgag
catggcgacacccgcgaaagcctgtcggtgtccgattcgcttcaacaaacaccaacttac
actggcgaccagctcgacacgtcgcaagacagtctggagatagacgacgacaacgcatcc
accgtgagccacctgagtgatctcagtggattgtctgagttgtccggtcaggattggaag
cccatggcgggtagtatgatatggatccaaaaacaaatggcacacggtgtcaatccacgt
atgatactgtcagatttgggtgtcgaactagatcagattcctcagtacgttgacgaagtc
acattgtggaaactaatcataaacatgttggcggaaccacccagacgaaacaagctgcgg
catgttaacacattggacgacgttgtgcgactgctgcgtggcgcacagaaaattatagtt
ttgacgggtgcaggcgtgtcggtgtcatgtggtattcccgacttcaggtctagggacggc
atctactccagattagcgatcgactttcccaatcttccagacccccaggccatgttcgac
attagctactttagccaggatccccgaccgttctataaattcgccagagatatctatccg
ggaaagtttcaacctagtccgtgccacagattcataaagctgctcgaaaagcacaagaag
cttttgaggaactacacacagaacatcgacactttggaaaaggaggcgaacattgaacgg
gtgatcgagtgtcacggatcttttgcgactgcgacttgcaccaaatgtggacacaaagta
acagcaaataacattcgcgaaacagttcttgcacagaaaataccattatgcgaggtgtgt
catgcaggcgaagagtcgtcagtgtccacggatgatctcggagaagagcgcgattatcgt
ggtctcgtcgcctccggcatcatgaaacccgacatagtgttcttcggcgagggactgcct
gatacctttcacgaagctatgtcggctgataaaacagaatgcgatcttctgttggtgatc
ggaagctcgcttaaagtacgacctgttgctcttatacccagctcgttgccggcccacata
cctcagattttgatcaaccgagaaccactgcatcattgtcgtttcgatgttgaactcctg
ggagattgtgacgtcatcattaatcacttgtgtcaattattaggtaatagttgggaagaa
ggtatatactcaacagatgtactcaaagaatctcccctattgccagttccgaatccatta
agaccttacgaaaacagaacagaaaccgagccaaattatacagtagatatgccagaaaca
gaaaaagaattctcatgcgaatgcaatagtagtacaaatgccagttccttcaatattgaa
aaaaatgtagatgttagctgctcatgtagtcacgctcaaatgtcaattagtcaggacgac
tttgacgatctaaagcaaacgaaagaacgtcacatgtcaatagattcggcaagggattcg
ggaattggggacaattcgaatttcacagatctggagacgaaatacgatgatacctccgac
gacaacaaggacgagagtgatgtcgaacccaaagtgtaccccacatctaaaacggaaagt
aacggtgagagttcgaatactgagctgcgtggtctttggcaaccgaaaatcaagaaaagt
ctggctgatcgactaccgccaaactcttatcacataataccaccgagccggtacatattt
cctggggcagaggttttctacgatccagacgatggatgtccccaaaaaactgagtcgtcg
acgtcgtcgtcggactctgattctgacagtgaagatataaatatttaa

DBGET integrated database retrieval system