KEGG   Aethina tumida (small hive beetle): 109598033
Entry
109598033         CDS       T06105                                 

Definition
(RefSeq) fibroblast growth factor 1-like
  KO
K18496  fibroblast growth factor 1
Organism
atd  Aethina tumida (small hive beetle)
Brite
KEGG Orthology (KO) [BR:atd00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:atd04052]
    109598033
   00536 Glycosaminoglycan binding proteins [BR:atd00536]
    109598033
Cytokines and growth factors [BR:atd04052]
 Growth factors
  Growth factors (RTK binding)
   109598033
Glycosaminoglycan binding proteins [BR:atd00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   109598033
SSDB
Motif
Pfam: FGF IL1
Other DBs
NCBI-GeneID: 109598033
NCBI-ProteinID: XP_019869400
LinkDB
Position
Unknown
AA seq 132 aa
MGPFGNEFKLYCERGFHLAVRGNGIIEGTDELNDCDTDLICSSADNESEVRLKGKYTGRY
ICFGEEGQLYGEEDVNNPGTKFIESFAGSYTCYESATYPKWYIGLNKQLKSKPGPRTTWG
KKSTKFLPRRQS
NT seq 399 nt   +upstreamnt  +downstreamnt
atgggtccgtttgggaacgaatttaaattgtactgtgaaagaggtttccatttagccgta
agagggaatggaataatagaagggactgatgagttaaatgactgcgacactgatttaata
tgttcttccgctgataatgaaagcgaggtgagactaaaaggtaaatacactggaagatac
atttgctttggtgaagaaggacaattatatggagaggaagatgtcaataatccaggaact
aaatttatagaaagttttgctggttcatacacctgctacgaatcagcaacatatcctaaa
tggtatattggtttaaacaagcaattgaaatcaaaaccaggccctagaacaacatgggga
aagaagtccaccaaatttttgccccgacgacaatcataa

DBGET integrated database retrieval system