KEGG   Aethina tumida (small hive beetle): 109598093
Entry
109598093         CDS       T06105                                 

Definition
(RefSeq) mothers against decapentaplegic homolog 4
  KO
K04501  mothers against decapentaplegic homolog 4
Organism
atd  Aethina tumida (small hive beetle)
Pathway
atd04068  FoxO signaling pathway
atd04310  Wnt signaling pathway
atd04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:atd00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    109598093
   04350 TGF-beta signaling pathway
    109598093
   04068 FoxO signaling pathway
    109598093
SSDB
Motif
Pfam: MH2 MH1 Glycos_transf_N
Other DBs
NCBI-GeneID: 109598093
NCBI-ProteinID: XP_019869484
LinkDB
Position
Unknown
AA seq 635 aa
MSGLSANAPSSADACLSIVHSLMCHRQGGESEGFAKRAIESLVKKLKEKRDELDSLITAI
TTSGAHQSKCVTIQRTLDGRLQVAGRKGFPHVIYARIWRWPDLHKNELKHVKYCQFAFDL
KCDSVCVNPYHYERVVSPGIDLSGLTLQAGTPRMVKDEYTAGPVPGSSMDVDGELGMGVS
QTIQHHPPQQNFPLTALHPSPPSDPGIYNTTNRAVLGPPTVPKIEGGPEACSRSNWLPHI
HLPCHNNQNSVQTGMSNQQTNTGTPLHVAPPTHNNQAQFYNAAQNPGVQDRPTPDAMPQN
IGNNSPVSPHMQQNGFNNSPNPSVATNNGSVSGSQPTATMGQTFTGAGGTWTGSNTLTYT
QSMQPPEQRVHHNNYWSNHSAATNQMSTEVNIAGGLLSTQPAPEYWCSVAYFELDTQVGE
TFKVPSNCPNVTIDGYVDPSGGNRFCLGALSNVHRTDQSERARLHIGKGVQLDLQGEGDV
WLRCLSDHSVFVQSYYLDREAGRQPGDAVHKIYPAAYIKVFDLRQCHHQMTSQAATAQAA
AAAQAAAVAGHIPGPHSVGGIAPAISLSASTGIGVDDLRRLCILRLSFVKGWGPDYHRQS
IKQTPCWIEVHLHRALQLLDEVLHTMPIDGARGIE
NT seq 1908 nt   +upstreamnt  +downstreamnt
atgtctggcttatcggcaaacgctccctcatcggctgacgcatgcttgagcatagtccac
agtttgatgtgccaccggcaaggtggcgagagtgagggcttcgctaaacgagcgatcgag
tccctcgtcaagaagctgaaagagaaacgcgacgaattggactcgctgattactgccata
acgacaagtggcgcccaccaaagcaaatgcgttaccatacaacgcaccttggacggacgt
ctgcaggtggccggtcgcaagggtttccctcacgtgatttacgcgaggatatggcgctgg
cccgacctccacaagaacgaactaaaacacgtaaaatactgtcagttcgcgttcgacctg
aagtgcgactcagtatgcgtgaatccgtaccattacgagagggtggtgtcgccgggcatc
gatttgtctggactgactttgcaggccggtacgccgaggatggttaaggatgagtatacg
gctgggccggtgccgggcagcagcatggatgtggacggggagttggggatgggggtgtca
cagaccatacagcaccacccgccacaacaaaactttcctcttacagcgttacatccctca
ccgccgagtgatccgggaatatataatacaacaaatagagcagtcttgggaccacctact
gtaccaaaaattgaggggggaccagaagcatgttcaagatcaaattggttgccacatatt
catttgccttgtcacaataatcaaaatagcgtgcaaaccggcatgagtaaccagcagacg
aacacgggaacacccctgcacgtggcgccacccacacacaacaaccaagcccagttctac
aacgccgcccagaatccgggcgttcaggacagacctacacccgacgcaatgcctcagaat
attggcaacaactctcctgtgtcgcctcacatgcagcaaaacggcttcaacaactcgccg
aatccgagtgtggccacgaacaatggttccgtgtcgggcagtcagcctacggccacgatg
ggacagacgttcaccggagctggcggtacttggacaggttcgaacaccctgacctacacc
cagtcgatgcagccacccgaacagagggtccaccacaacaattattggagcaaccactcg
gcggccacgaaccagatgagcacggaggtgaacattgcaggcggcctgctgtcgacgcag
cccgcccccgaatactggtgctccgtggcttacttcgagctggacacccaagtgggtgag
acgttcaaggtgccatcgaactgtccgaacgtgacgatcgacggctacgtggatccgtcg
ggcggcaatcgattttgtctcggcgccttgagcaacgtgcaccggaccgaccagagcgag
agggcccggctgcacatcgggaaaggtgtgcagctagacttgcagggagagggtgatgtg
tggctgcgatgtctgagtgaccattcagtattcgttcagagctactatctggacagggaa
gctggacggcaacccggagatgcagtacacaaaatttatccggctgcttacatcaaggtt
ttcgatttacgacaatgtcaccaccaaatgacatcacaggcagcaactgcccaagcggcc
gccgcggctcaggctgctgccgtcgccgggcacattcctggaccgcactcagttggagga
attgctcccgccatcagtctatccgcatcgaccggcattggtgtggacgatttaaggaga
ctgtgcatactgcgattgagcttcgtgaagggctggggaccagactatcatcgacagtcg
attaagcagactccctgctggatagaggtgcatcttcaccgggcgttgcagcttttagac
gaggttttgcacaccatgccaatcgatggggcccgcggcatcgagtaa

DBGET integrated database retrieval system