KEGG   Aethina tumida (small hive beetle): 109598230
Entry
109598230         CDS       T06105                                 

Definition
(RefSeq) insulin receptor substrate 1 isoform X1
  KO
K16172  insulin receptor substrate 1
Organism
atd  Aethina tumida (small hive beetle)
Pathway
atd04068  FoxO signaling pathway
atd04140  Autophagy - animal
atd04150  mTOR signaling pathway
atd04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:atd00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    109598230
   04150 mTOR signaling pathway
    109598230
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    109598230
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    109598230
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:atd04990]
    109598230
Domain-containing proteins not elsewhere classified [BR:atd04990]
 Phosphotyrosine binding (PTB) domain-containing proteins
  IRS related family proteins
   109598230
SSDB
Motif
Pfam: IRS PH PH_11
Other DBs
NCBI-GeneID: 109598230
NCBI-ProteinID: XP_019869649
LinkDB
Position
Unknown
AA seq 1190 aa
MSVKSSGSDGAPDKGQAVRSGYLRKFKTMKKKWFVLRAESADRPARLEYYDSEKKYNCGA
DAKRSIPLKTCFNINKRKDVKHKHVLALYTKDECFSIQLDSEDELDGWLKALLTLQHGDD
AADGETPKPTYEHIWQVQIMNRGIGTSSLTGSYRFCLTGKKLKLIKKDSETCIDLVLSNI
RSCGYLKEYFYLEVGRSSTLGPGELWMNTGDENIAQNIHSTVYHAMSTNTSNNELGPKSR
NRSSSATEASKPNSAQRKPNHIGVPKTHILQQDPNSTECQVTPPVTTTSTQHPIVSGVAS
IYHHLIQRGTAKASERRHSISAGGLNWSGTICHQRTQSLPLAHPTTTTTAPTFTDQNTTT
TSSHPLRVNKRPSSKCASGGGRERCDSMPTRPRTTSEGNHVGIWAKTLSITSSYRSAHNR
DISHSPPSGIATSPPSVGYSESSGSSYSLADEPEEGDIIGRYSHPLTPEEAIAEEDSPDS
PCMNTNYVPMAPPSSDDGYVDMSPGGGRTTASPTHSMNSITSGTPSTDIRFSEYPLEKVA
SYLTSDDDDTRPTRAYSVGSKPDSYKNKKHLEHVGTPDNSRVRAFSVGSKTKKGPSRVLP
HHAHTGAKSSSAPMLMQRMHSSHGSIGPMDDLMEMDFSNSTSGHNSVSDYMDMKPGSTTP
SGYVEMKPGSIEKSSVATEAPYMDMSGSSPARSNANDVTFVDMSRLVDNSDYMDMQPKRT
SQPPTWQQNTSHNEPFDLNNYSVRQVDRHGSFSSQLSASPNKYHSISPKYTEGWVNSHYH
TPTTPEGYVEMTPGQTNRHQRQSSLDSTHIQVYDDYTNMTLGNSKLKNKPVKKEMKSQPI
MIQGGNNGKIASSPASISPLQVGRKYSTGTPPSFHLPLQAQYSSSLPRPRSRKNSRRDSK
DSSSSSVTTPSSSSTIFSMSLNSPSSPAKPAQTIKVPASVMNVKYKATNMSKANSEDYTM
MDYEKAARKPDASEYVNYNPAPAYHHQLPFRSTRNITRRNDEEGDYALMKPGEIEVKKDL
PNVGFQPINDEKYRTSPRPGDTVPDIANRGDNHQDTARLKSIKEQKPETRPASVGSDGNN
KPSRPSSTSSELCSSTSTLTGSRPESVNSDRIPQENTRPASVTCDLQLHYASLDLAPTDE
TGNKSPRSSKSTTQQEGGSAEPAFTYAEIDFVKSEGLKHNSLPNNAKVKH
NT seq 3573 nt   +upstreamnt  +downstreamnt
atgtcggtgaagtcgtccggttcggacggcgcgccggacaagggccaggccgtccgttcc
ggctacctacgcaagttcaagacgatgaagaagaagtggttcgtgctgcgggccgagtcc
gccgatcggcccgcccgtctcgagtactacgactccgagaagaagtacaattgtggcgcg
gacgcgaaacgcagcatccccctgaagacgtgcttcaacatcaacaagcgcaaggacgtc
aagcacaagcatgtgctggcgctctacactaaggacgagtgcttctcgatccagctggac
tcggaggacgagctggacgggtggctgaaggcgttgctcaccctccagcacggcgacgac
gccgccgacggcgaaactcccaaacccacctacgagcacatttggcaggtccaaataatg
aacaggggaatcgggacttcaagcctgaccggcagctaccgattctgtttaaccggcaag
aagttgaagctgatcaagaaggattcggagacgtgcatcgatctggtcctgagcaacatc
cgcagctgcggatacctcaaggagtacttctatctggaggtgggaagatcgagcacattg
ggccccggcgaactgtggatgaacacaggtgacgagaatatcgcccagaacattcactcg
actgtttaccatgcaatgtcaaccaacacctcgaacaacgagctcggcccgaagagcagg
aacagatcctcctcagcaaccgaggcatccaaaccaaattcggcgcaaaggaagcccaac
catataggtgtaccaaagacgcatattttgcaacaagatcccaattccaccgagtgtcaa
gtcactcctccagtaacaaccacgtcaactcagcaccctatcgtcagcggtgtggcaagt
atttatcaccatctaatacagaggggaaccgctaaagcttccgaacgtcgacattctata
tcagcagggggcctaaactggtctgggactatatgccatcagcgtactcagtcgcttccc
ctagcgcaccccaccactacaaccacagcacccaccttcacagatcaaaacacaaccacc
acttcttctcaccccctaagagtcaataaacgtccatcctcgaagtgcgcctccggcggt
ggaagagaacgatgcgacagcatgccgacaaggccgcgcaccaccagtgagggcaaccac
gttggcatctgggctaaaacgctctcgatcacgtcgtcgtaccgttcggctcacaaccgc
gacatctcccacagtcccccatcgggaatcgccacgagcccgccgtcggtcggttattcc
gagtcgtccggctcgtcctacagtttggcggatgaaccggaggaaggggacataatagga
aggtacagccatccgttgacacccgaggaggcgatcgcggaggaggacagtccggattcg
ccttgcatgaacacgaattacgtgcccatggcgccgcctagcagcgacgacggttatgtg
gacatgtcgcccggtggcggaaggaccacagcttcccccactcacagcatgaacagtata
acgtcgggcactccgtcgacggacatccgtttctcggaatacccattggagaaggtggcg
tcttatctgacatcggacgatgacgatacccgtccaactcgggcgtattccgtcggctcc
aaaccggattcatataagaacaaaaaacatttggaacacgtgggaacgcccgacaactcg
agggtgcgcgcgttctccgtcggttccaaaacaaagaagggtccgagtagagtgttaccg
catcacgcgcacaccggagccaagtcttcgagcgcgccgatgctgatgcaacgaatgcac
agctctcacggttccatcggtcctatggacgatctaatggagatggacttctcaaactcc
acgtccggccacaactccgtgtccgactacatggacatgaaaccgggatccaccacgccg
agtggttatgtcgaaatgaagccgggaagtatcgagaagagttccgttgcgacggaggct
ccgtacatggacatgagcggttcttcgccagccaggtctaatgccaacgacgtgaccttc
gttgacatgtccaggttggtggataacagcgattacatggacatgcaacccaagaggacg
tcgcaaccacccacatggcagcagaatactagtcacaacgagccgttcgatctgaacaac
tacagcgtaagacaggtggatcggcacggttccttcagttcgcagctgagcgcctcgccc
aacaagtatcattcgatttcgccgaaatacaccgaggggtgggttaactcccactatcac
acgccgacaacacccgaggggtacgtcgagatgactcctggccagaccaatcgtcaccaa
agacagtcgagtctggacagcactcacatccaggtgtacgacgattataccaacatgact
ctgggcaactccaagttaaaaaacaagccggtcaaaaaggagatgaaaagtcagccgatt
atgatacagggtgggaacaatgggaagattgcgtcgagcccggcttcgataagtcctctg
caggtcggaaggaaatactcaacgggcacgccgcctagcttccatttgccactgcaggcg
cagtactcctcaagtcttccaagaccgcgttccaggaaaaacagtcgcagagattccaaa
gatagcagtagttctagtgttacgacaccgtcaagttcaagcacgattttttccatgagc
ttgaacagtcccagttcacccgccaaacctgcacaaactattaaggtaccagcgtccgtt
atgaacgttaaatacaaggcgaccaatatgagtaaggcgaacagcgaggattacacgatg
atggattacgagaaggcagctaggaaaccagacgcaagcgagtacgttaactacaacccg
gctccggcataccaccaccagttacccttcagaagtaccagaaatatcacccggagaaac
gacgaggaaggagactatgcattaatgaaaccaggcgagatcgaagtgaaaaaggatctc
cccaacgtcggtttccaaccaatcaacgatgagaagtaccgaacgtcacctcgtccaggt
gacactgtaccggacatcgccaaccgcggcgacaaccaccaagacacggctaggttgaaa
tccataaaagaacagaagcctgaaactagacctgcatcagtgggatcagacggcaacaac
aaaccgtcgaggcccagctccacctcgagcgagctgtgctcctccacctccaccttgact
gggtcgcgaccggaatcggtcaacagcgaccgaataccacaggagaacacgcgaccggct
tcggtcacgtgcgatttgcagctgcactacgcgagcttggatctcgctcctaccgacgag
acgggcaacaagagcccgagaagctcgaagagtactacgcaacaagagggtgggagcgcc
gagccggctttcacgtacgcggaaatagactttgtgaagagtgagggcctgaagcataat
tccttacccaataacgctaaggttaagcattaa

DBGET integrated database retrieval system