KEGG   Aethina tumida (small hive beetle): 109598240
Entry
109598240         CDS       T06105                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: casein kinase I-like
  KO
K08960  casein kinase 1, epsilon [EC:2.7.11.1]
Organism
atd  Aethina tumida (small hive beetle)
Pathway
atd04068  FoxO signaling pathway
atd04310  Wnt signaling pathway
atd04341  Hedgehog signaling pathway - fly
atd04391  Hippo signaling pathway - fly
atd04392  Hippo signaling pathway - multiple species
atd04711  Circadian rhythm - fly
Brite
KEGG Orthology (KO) [BR:atd00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    109598240
   04341 Hedgehog signaling pathway - fly
    109598240
   04391 Hippo signaling pathway - fly
    109598240
   04392 Hippo signaling pathway - multiple species
    109598240
   04068 FoxO signaling pathway
    109598240
 09150 Organismal Systems
  09159 Environmental adaptation
   04711 Circadian rhythm - fly
    109598240
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:atd01001]
    109598240
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:atd03036]
    109598240
Enzymes [BR:atd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     109598240
Protein kinases [BR:atd01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   109598240
Chromosome and associated proteins [BR:atd03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    109598240
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal APH Pox_ser-thr_kin
Other DBs
NCBI-GeneID: 109598240
NCBI-ProteinID: XP_019869669
LinkDB
Position
Unknown
AA seq 463 aa
MELRVGNKYRLGRKIGSGSFGDIYLGTNISTGEEVAIKLARMHKTRHPQLHIESKFYKMM
QGGVGIPQIKWCGSEGDYNVMVMELLGPSLEDLFNFCSRRFSLKTVLLLADQLISRTDFI
HSRNFIHRDIKPDNFLMGLGKKGNLVYIIDFGLAKKYRDSRTHQHIPYKENKNLTGTARY
ASINTHLGIEQSRRDDLESLGYVLMYFNRGSLPWQGLKAATKRQKYERISEKKMSTPIED
LCKGYPVEFPTYLIYCRQLRFEERPDYSYLRQLFRTLFHRQGFTYDYVFDWNMLKFGGSR
GSHCEENTGRSGAGGTRFGAHGAAPADAAPAVPQQPRQRRPPHDGRMDVSSGNTAGPPTT
LEDVITGSSPRMYDSHERRVSMRLRAGQGAPNASTSDLSTSKQANASVAAMAPPAQATTA
MQQAGGPGAPPRRGSASKDPPSGQRGVAAAEDGRQAAPRGGRH
NT seq 1392 nt   +upstreamnt  +downstreamnt
atggaactgagagtgggcaacaagtacaggctgggccgcaaaatcggttccggttccttc
ggcgacatctacttagggaccaacatatccaccggcgaggaagtggctattaaactagct
agaatgcataaaacgcgacacccgcagctccacatcgagtccaagttttacaagatgatg
cagggtggagtgggcatcccgcagataaagtggtgcggctcggagggcgactacaacgtc
atggtgatggagctgttgggcccgtcgttagaggacctgttcaacttttgttcgcgccgt
ttctcgttgaaaacggtcctactgctggccgaccagctgatctcgcgcaccgacttcata
cactcgcgcaacttcattcatcgcgacatcaaaccggacaacttcctaatgggactcggc
aagaagggcaacctggtctacataatcgatttcgggctggcgaaaaaatacagggacagc
aggacccaccagcacataccctacaaggagaacaagaatttgactggtaccgcaaggtac
gctagcataaacacccacttaggcatagagcagtcgcgaagagacgacttagaatcatta
ggttacgtattaatgtacttcaataggggatcgttgccgtggcagggcctgaaggcggcg
accaaacgccaaaagtatgaaagaatctccgagaagaagatgtccacgcctatcgaggac
ttgtgtaaaggttatccagtagaatttcccacatacttaatatactgccgacagctgagg
ttcgaggaaagaccggactacagctacttgaggcaactcttccggacgctcttccaccga
cagggattcacatatgactacgtgttcgactggaatatgctcaaatttggtggatctcgg
ggcagccattgcgaagagaacaccggtcgatcgggtgcgggagggacgcgtttcggcgcg
catggtgccgccccggcggacgcggcgcccgccgtgccgcagcagccgcgacaaagacgg
ccgccccacgacgggcgcatggacgtcagcagcggcaacacggccggtccgcccaccacg
ctcgaggacgtcatcaccggcagttcgccacggatgtatgatagtcacgaaaggcgggta
tctatgaggctgagagcggggcaaggtgcccccaacgcctccacctcggacctaagcaca
tcaaaacaggccaacgcctccgtagcggcaatggcgccgcccgcgcaggccacgacggcg
atgcagcaggcggggggcccgggggcgccgcctagaaggggtagcgcctccaaggacccg
ccgtcgggacagcggggcgtcgcggccgccgaggacggacgtcaagcggcgccgcgtggc
ggccgtcactga

DBGET integrated database retrieval system