KEGG   Aethina tumida (small hive beetle): 109599040
Entry
109599040         CDS       T06105                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: adenylate cyclase type 3-like
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
atd  Aethina tumida (small hive beetle)
Pathway
atd00230  Purine metabolism
atd01100  Metabolic pathways
atd04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:atd00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    109599040
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    109599040
Enzymes [BR:atd01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     109599040
SSDB
Motif
Pfam: Guanylate_cyc AC_N Mycoplasma_p37
Other DBs
NCBI-GeneID: 109599040
NCBI-ProteinID: XP_019870532
LinkDB
Position
Unknown
AA seq 1081 aa
MTMEEQKDKDRDKMKEKCFLVSTFTDSSLERLYQSFSVKQKRAGLECFLIAAILFDIYMI
AVPSGQDLFILVFMGAFLVMNCSLLIWCKQNYKSKLIWAAIPHISWHIANAQVLAALFLK
KNEVTSRDSLGWVLLLDYLIYVTLPLRLRYCIILSIGTCTSYIAAVIGLSKSNLHFVEQH
VSNFILLFTTNLLGLTLYLVDDKQQRRAFLETRQSLQMKLVIEEQSTEQENLLLSVLPEH
VAVEMRQDLDQTDSQFKKIYMNRHENVSILYADIVGFTAISSTYSAQELVKMLNELFARF
DKLAEKYQQLRIKILGDCYYCISGAPKEKPDHAVLCVHMGLSMVKAIKYVQQTANSPVDM
RVGIHTGAVLAGVLGQRQWQFDVYSKDVELANKMESSGMAGRVHISATTLSFLNGEFEVE
PAYGEKRDEALRIAGLKTYFIVRVLKPFQESKAEVQNGGGIMPDEESCVIADISSDVKEE
EANKTNVNRCRTDSADFKIRLRKELVSRDGHKELSKNTKLITLAFTDPQKEKSYHQHIET
FSSFTLLMFLIVRLAIAVTTFIIMPSDLTVDFAYCTQNSVFMLLVIVTIVEEYPVTPKCW
RVFKESMALRRILSTTCIVLLGSVNIIDTVSCSQFQRGPDNCSSTEDLNSACLYPSYFSY
YLVLILVASSLPTCLSYLWKSILMILITCVQCLVNIFVLGSALDCEESRKHWTSLTKGKY
TLSGLLLTATLVLSFLTRHMEQVARVLFLWRSEVDEQRDFAEDMKRRNEALVYNILPPHV
ATHFMGNRNRKHDELYSQSYAEVGVLFASMPNFSDFYSEETVNNQGLECLRFLNEVISDF
DALLEWPQFQDVIKIKTIGSTYMAASGLNPTRQPDDPITIRWTHLALLVEFALELKKALQ
SINEQSFNHFVLKLGINHGPITAGVIGARKPHYDIWGNTVNVASRMESTGKAGCIQVTEE
TCQILQHFGYLFEQRGLVAVKGKGQLMTYYLLGKCGKMSPSTAPASPGAITMEMVKEEDE
SHDSSTSKSDEKTVMECNLTKDFSTDNENDLINTEEYQTIINQDSEMKDSTENCLLLSNC
D
NT seq 3246 nt   +upstreamnt  +downstreamnt
atgaccatggaggagcaaaaagataaagatcgtgacaagatgaaggaaaagtgctttttg
gtgagcacttttaccgattcctctttagaaagattgtaccaaagctttagcgttaaacaa
aaaagggccggtctcgaatgtttcctaattgctgctattttattcgatatttacatgatt
gcagttcctagtggtcaagatttgtttattttggtttttatgggggcatttttggtaatg
aactgttccttattaatatggtgcaagcaaaattacaaatcgaaattaatttgggcggca
attccgcacataagttggcacattgctaatgctcaagttttggcggcgttatttttaaag
aagaacgaagttacatcgagggacagtttgggttgggtgttgctcttggactacttaatt
tatgttactttaccattaagattgagatattgcataattctgagcatagggacttgtact
tcgtatattgctgctgttattggactttctaaatctaatttacattttgtcgaacagcat
gtatcaaattttatattgttgtttacaacaaacttattgggcttaacgttgtatttggtg
gatgataaacaacaacggcgagctttcttagaaacaagacaatctcttcaaatgaaattg
gtaatagaggaacaaagtaccgaacaggaaaatcttctcctgtcggttttgccagaacac
gtggctgtggaaatgaggcaagacctggaccaaactgacagtcaatttaagaagatttac
atgaacaggcatgagaacgtaagtattttgtacgcagacatcgtaggattcacggcaata
tcgtcgacctattccgctcaagaactggtcaaaatgctgaacgaattgttcgccagattt
gataaacttgccgagaaataccaacaattgaggataaaaatattgggcgactgctattat
tgtattagtggtgcacccaaagaaaaaccagaccatgctgttttatgtgtacatatgggg
ctatcgatggtcaaagcaataaaatatgttcaacaaacggcgaattccccggttgacatg
agagtcggtattcataccggtgctgttttagctggtgttttgggccaaaggcaatggcaa
ttcgatgtttattcgaaagatgttgaactcgcaaataaaatggagagcagcggaatggca
gggagggttcatatttcagcgacaacgctttcgtttcttaacggagagtttgaagttgaa
ccagcttatggtgagaaaagagatgaggcgcttagaatagctggcttaaaaacttatttc
attgtcagagttcttaaaccattccaggaatcaaaggccgaagtacaaaatggtggtgga
attatgccagatgaagaaagttgtgtaatagctgatatatcttcggatgtgaaagaagaa
gaggctaacaaaacgaacgttaacagatgcagaacagattcggcagactttaaaatccga
ttaaggaaggaattagttagcagagatggacacaaagaattgtcgaagaacacaaaatta
atcacgttagcatttacagacccgcaaaaagagaaatcatatcatcaacacattgaaact
ttttccagttttactttattgatgtttttaatagtgagattagccatagctgttaccaca
tttataattatgccaagcgaccttactgtcgactttgcatattgtacacagaattcagta
tttatgttattagtgattgttaccatagtggaagaatatccggtcacgcctaaatgttgg
agagttttcaaggaatcgatggctttacggcgaattctatcaacgacttgtatagtacta
ttagggtccgtaaatataattgatacggtttcatgcagccaattccaaaggggtccagat
aattgttcatcaacagaggatttaaattctgcatgtttatatccttcttactttagttat
tatttagttttaattttggtcgcttcttctctacctacatgtttatcatatttatggaaa
agtatactaatgatattaataacttgtgtgcaatgtttagttaatatattcgtcttgggt
tcagcgttagactgtgaggaatctcgtaaacattggactagcctaactaaaggtaaatat
acactctccggcctactattaactgctacgttggtattgtcctttctaacaagacatatg
gaacaagtggcacgtgttttgtttttatggcgttctgaagtagatgagcaacgtgatttt
gctgaagacatgaaacgacgaaatgaagctctcgtttataatattttaccaccacacgtt
gcaacccatttcatgggtaatagaaatagaaaacacgacgaactttactcccagagctat
gcagaagttggtgttctattcgcttctatgcctaatttttcagatttttattcggaagaa
accgtaaacaatcaaggtcttgaatgtttaagatttttaaacgaagtgatatctgatttt
gatgcgcttttagaatggcctcagtttcaagatgttattaaaattaagacaatcggctct
acttacatggcagccagtgggctcaatccaacaagacaacctgatgatccaataaccatt
cgctggacccatttagctttattagtcgagtttgctctggagttaaagaaagctctgcaa
agcattaacgaacaatcgttcaatcacttcgtgctcaagttaggaatcaatcatggacct
attacagcgggcgtgatcggtgccagaaaaccccattatgatatttggggaaacactgtg
aatgttgcttctagaatggagagtacgggaaaagcaggctgtattcaggttaccgaggaa
acatgtcaaattcttcaacatttcgggtacctattcgaacaacgcggtctcgttgcagtt
aaaggcaaaggtcaattgatgacctattatttgttagggaaatgtggaaaaatgtctcca
agtacagccccagcttcacctggagcaataacaatggaaatggtgaaagaagaagacgaa
tcccacgatagctccacatcaaaatcagatgagaaaactgttatggaatgtaatttaacc
aaagattttagtacagacaatgaaaatgacctaataaatacagaagagtaccaaacaatt
atcaatcaagattcggaaatgaaggattcaaccgaaaattgtcttctcttgagcaattgc
gattaa

DBGET integrated database retrieval system