KEGG   Aethina tumida (small hive beetle): 109602084
Entry
109602084         CDS       T06105                                 

Definition
(RefSeq) bcl-2-related ovarian killer protein homolog A-like
  KO
K20017  Bcl-2 family protein
Organism
atd  Aethina tumida (small hive beetle)
Pathway
atd04214  Apoptosis - fly
atd04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:atd00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    109602084
   04215 Apoptosis - multiple species
    109602084
SSDB
Motif
Pfam: Bcl-2
Other DBs
NCBI-GeneID: 109602084
NCBI-ProteinID: XP_019873972
LinkDB
Position
Unknown
AA seq 271 aa
METPNPPVNIDKRFPSVPFNPRRKLSIPVAFSAQNIEQIAIRRRFSNVGDAVTRKLSTTI
GWRGIGSGKPPEEVVAIGRALCTLYVRSRLKRACVFNRKLGLTRVRSAVGTLTGCGAVVR
EVFPCLACACNELERMFPRLYSNITRQTGPSPGGGISGLLLAFGHHILRSQPSWGKVVAI
YSVAGGLAVDCVRQGHHDDLHVLLEDMTELLEDRLAHWVHANGGWAGLTSQCLDQDQEIS
IVEYLTIFGLVGTILLVAYFLVRFFVSFSLL
NT seq 816 nt   +upstreamnt  +downstreamnt
atggagacgccgaatcctccggttaacatcgacaagaggttcccgagcgtgccgttcaac
ccgcgcaggaagctgagcatccccgtggccttctctgcgcagaacatcgaacagatcgcg
atacgcaggcgcttcagtaacgtgggcgatgccgtcacccggaaactttcgactacgatc
ggatggcgggggatcggaagtggtaaacctccggaggaggttgtggccataggaagggcc
ctttgcaccctgtacgtgaggagcaggctgaagagggcttgtgttttcaacaggaagctg
gggctgacgagagtcaggagtgccgttggcactttgacaggttgtggcgcagtagtcaga
gaagtattcccatgcctggcctgtgcctgcaacgaattggaacggatgttcccgagactc
tattccaacatcacgagacaaacgggtccttctccgggaggaggcatttccggattgctg
ctggcctttggccaccatattttgaggtcgcagccttcctgggggaaggtggtggcgatt
tacagtgtggccggtggtttggccgtggactgcgttcgacagggacaccacgatgacctg
cacgtgcttttggaggacatgactgagcttttggaggaccgtttggcccattgggtccac
gcgaacggtggatgggccggactgacttctcagtgtttagatcaggatcaggaaatctca
atagtggagtacttaacgatctttggacttgtagggacgattttgttggtagcttatttc
ttggtacgattttttgtttcgtttagcctgttgtaa

DBGET integrated database retrieval system