KEGG   Aethina tumida (small hive beetle): 109602307
Entry
109602307         CDS       T06105                                 

Definition
(RefSeq) tumor necrosis factor receptor superfamily member wengen isoform X1
  KO
K16679  wengen
Organism
atd  Aethina tumida (small hive beetle)
Pathway
atd04013  MAPK signaling pathway - fly
atd04214  Apoptosis - fly
atd04215  Apoptosis - multiple species
atd04391  Hippo signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:atd00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    109602307
   04391 Hippo signaling pathway - fly
    109602307
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    109602307
   04215 Apoptosis - multiple species
    109602307
SSDB
Motif
Pfam: TNFR_c6 stn_TNFRSF12A Sec62 SID-1_RNA_chan Coiled-coil_56
Other DBs
NCBI-GeneID: 109602307
NCBI-ProteinID: XP_019874208
LinkDB
Position
Unknown
AA seq 234 aa
MTSDIKVMVSVISVLLVSCFASCANALICTEGQYWNQDLQICSECSNCPVGQPVKAKCES
YRDTICYTQEEFLKTIEQHRYRHGHNQRQRGRQRHDDKGLRSPNEPSTMPLKDDATFSTA
ETLVWDWQAISLTLGVFACILFFVVITIYSLYQARQWKRLKESYEADLEELEKFSLMSSA
CKKEGLEEGDFRQIHSSEEDSNRCVYLEQLLVNVRKDEKMGKKPKGNVYIEESI
NT seq 705 nt   +upstreamnt  +downstreamnt
atgacgtcggacataaaggtgatggtgtcagtcatttcagtgctgctagtgtcttgcttc
gcatcgtgtgcaaacgctctaatttgtacggagggacagtattggaaccaggatctgcag
atttgttcggagtgctcgaactgtccggttggtcaaccagtcaaggcgaagtgcgaatcg
tacagggacaccatctgttacacgcaggaggagttcctcaagaccatcgaacagcatcgt
tacagacacggacacaaccagcgacagcggggccgtcagcgccacgatgataagggcctg
agatcgccgaacgagccctcaacgatgccgcttaaggacgacgccacgttttcgaccgcc
gaaaccctggtttgggactggcaggcgatctcactcacgctgggcgtcttcgcctgcata
ttgttcttcgtcgtcatcaccatctactcgttgtaccaagccaggcagtggaagagactg
aaagagtcatacgaagctgatctagaggaactagaaaaattcagcttaatgtcatctgcc
tgtaaaaaggaaggacttgaggagggagactttcgacagattcattcatcagaagaggat
agtaatagatgtgtttatttagaacaactgctagtgaacgttcgcaaagacgagaaaatg
ggcaaaaaaccgaagggcaacgtctatatagaggagtcaatatga

DBGET integrated database retrieval system