KEGG   Aethina tumida (small hive beetle): 109602915
Entry
109602915         CDS       T06105                                 

Definition
(RefSeq) ras-like protein 1
  KO
K07827  GTPase KRas
Organism
atd  Aethina tumida (small hive beetle)
Pathway
atd04013  MAPK signaling pathway - fly
atd04068  FoxO signaling pathway
atd04137  Mitophagy - animal
atd04140  Autophagy - animal
atd04150  mTOR signaling pathway
atd04213  Longevity regulating pathway - multiple species
atd04214  Apoptosis - fly
atd04320  Dorso-ventral axis formation
Brite
KEGG Orthology (KO) [BR:atd00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    109602915
   04068 FoxO signaling pathway
    109602915
   04150 mTOR signaling pathway
    109602915
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    109602915
   04137 Mitophagy - animal
    109602915
  09143 Cell growth and death
   04214 Apoptosis - fly
    109602915
 09150 Organismal Systems
  09158 Development and regeneration
   04320 Dorso-ventral axis formation
    109602915
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    109602915
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:atd04131]
    109602915
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:atd04031]
    109602915
Membrane trafficking [BR:atd04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    109602915
GTP-binding proteins [BR:atd04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    109602915
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 Gtr1_RagA Septin AAA_25 FeoB_N Ser_hydrolase CbiA PglD_N
Other DBs
NCBI-GeneID: 109602915
NCBI-ProteinID: XP_019874918
LinkDB
Position
Unknown
AA seq 194 aa
MKMTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDNETCLLDILDT
AGQEEYSAMRDQYMRTGEGFLLVFAVNSAKSFEDIGTYREQIKRVKDAEEVPMVLVGNKC
DLTALVDMNQAKEIAKQYGIPFVETSAKTRMGVDDAFYTLVREIRKDKTRGRRYHKAGSH
ARGPFKFPSRCSIL
NT seq 585 nt   +upstreamnt  +downstreamnt
atgaaaatgactgaatataaattagtcgtagtaggcgccggtggtgtaggaaaatcggca
ttaacaatacagttaatacagaaccacttcgtagatgaatatgatccaactatagaagat
tcctatcgaaaacaagtagttattgacaatgaaacgtgcctgctggacattctcgacacg
gcaggacaagaagaatatagtgcaatgagggatcagtatatgaggacgggtgagggcttc
ctccttgtcttcgcagtcaactcagccaaaagtttcgaagacataggaacatatagagaa
caaattaaacgagtcaaagatgctgaagaagtgccaatggtccttgttgggaataaatgt
gatttaactgcattggttgacatgaatcaggctaaagagattgccaaacagtatgggatc
ccgttcgtggagacgtcggcgaagacccggatgggcgtggacgacgcgttctacacgctg
gtgcgcgagataaggaaggacaagacaaggggcaggcgctaccacaaggccgggtcgcac
gcccgcgggcccttcaagttcccgtcgcggtgctccatcctgtag

DBGET integrated database retrieval system