KEGG   Aethina tumida (small hive beetle): 109603279
Entry
109603279         CDS       T06105                                 

Definition
(RefSeq) forkhead box protein O
  KO
K09408  forkhead box protein O3
Organism
atd  Aethina tumida (small hive beetle)
Pathway
atd04068  FoxO signaling pathway
atd04137  Mitophagy - animal
atd04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:atd00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    109603279
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    109603279
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    109603279
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:atd03000]
    109603279
Transcription factors [BR:atd03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix other regulators
    109603279
SSDB
Motif
Pfam: Forkhead FOXO-TAD
Other DBs
NCBI-GeneID: 109603279
NCBI-ProteinID: XP_019875325
LinkDB
Position
Unknown
AA seq 507 aa
MNPDEYSGADQWQRQTMNLGVMEPLAEVDGFEPQTRARSNTWPLPRPENFVEPDENAAAA
AGNKCSGLPSAAPVPSSAVPAKKNSSRRNAWGNLSYADLITQAITTSPDKRLTLSQIYEW
MVQNVPYFKDKGDSNSSAGWKNSIRHNLSLHNRFMRVQNEGTGKSSWWMINPDAKPGKSV
RRRAASMETKQYEKRRGRVKKKVDIIRNGMNGLPDTTPSPSSSVSESLDLFPDSPPNMHG
GGGFQLSPDFRPRASSNTSSCGGRLSPIPAVVGPEPDWFPSTNNYSPEMQAGNYSPDQLA
GNLQQRMKLEPDSYLGSYMNGQTTQPPPPYPNYGEFQNSTFDICPRHQIQSCGCMQQIKV
ENCLPHIKAERMSPSGMSPSYSSSEQLPDTNTQYMLNATAIQQRTSGSPPINQQQPSTVM
GQLMGALNSSSSILDDLNINVESFQGGFDCNVEELIKHELNMDGSLDFNFANQQQTVGAP
AADNQATGQPGAPPAYPAAVTSPSWVH
NT seq 1524 nt   +upstreamnt  +downstreamnt
atgaatcccgatgagtattcgggcgccgaccagtggcaacggcagacgatgaacctgggc
gtgatggagccgctggccgaggtggacggtttcgagccgcagactcgcgccaggtccaac
acgtggccgctgccacggcccgagaacttcgtggagccggacgagaacgcggccgccgcg
gcgggcaacaagtgttccgggttgccgtcggccgcgccggtcccctctagcgccgtgccc
gccaagaagaattcgagcaggaggaatgcgtggggcaatctgagctacgccgatttgatc
acccaggcgatcaccacgtcgcctgataaacggctcaccctcagccagatctacgagtgg
atggtgcagaatgtgccctacttcaaggataaaggcgacagcaacagctcagcaggatgg
aagaactcgatacgacacaatctctcgttgcacaaccgtttcatgagggtccagaacgaa
ggcaccggcaaatcgtcgtggtggatgatcaaccccgacgccaagccgggcaagtcggtg
aggcgaagggccgcgtccatggaaacgaaacagtacgagaagcggcggggtcgtgtgaag
aaaaaggtcgacatcatcaggaacggtatgaacggccttccggacaccacgcctagtccc
agttcctcggtgtccgaaagcctggacctcttccccgactcaccaccgaatatgcacggt
ggtggcggcttccaactgagcccggacttcaggccacgcgcctcgtcgaacacgtcatcg
tgcggtggccgtttgtcccccattcctgccgtcgtcggtcccgaacctgactggttcccg
tcgacgaacaactacagccccgaaatgcaggccggcaactactcccctgaccagctggcc
ggcaacctgcagcagcgcatgaaactcgaacccgactcctatttggggagttatatgaat
gggcaaaccacgcaaccaccacctccgtatccgaattacggggagttccagaactcaacg
ttcgacatctgtccaagacatcagatccagtcctgtgggtgcatgcaacaaataaaagtc
gagaattgtttgccacacattaaagccgagcgaatgtcaccgtcgggaatgtcgccttcg
tactcgagttcggagcagctgccggacaccaacacccagtacatgctgaacgcaaccgcc
atccagcagcggacgtcaggcagcccgcccatcaaccaacagcaaccgtccacggtgatg
ggccagctgatgggtgctttgaacagcagcagctccatactcgacgatctcaacatcaac
gtcgaatcgttccagggcggcttcgattgcaacgtcgaggaactgatcaagcacgagctg
aacatggacggcagtctggacttcaacttcgccaatcagcagcaaacggtgggagcgccc
gccgccgacaaccaggcgacgggtcagccgggggcgccgcctgcctatcctgcagcggtc
accagtccttcgtgggtgcactaa

DBGET integrated database retrieval system