KEGG   Aethina tumida (small hive beetle): 109603469
Entry
109603469         CDS       T06105                                 

Definition
(RefSeq) mitogen-activated protein kinase 1
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
atd  Aethina tumida (small hive beetle)
Pathway
atd04013  MAPK signaling pathway - fly
atd04068  FoxO signaling pathway
atd04140  Autophagy - animal
atd04150  mTOR signaling pathway
atd04214  Apoptosis - fly
atd04320  Dorso-ventral axis formation
atd04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:atd00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    109603469
   04350 TGF-beta signaling pathway
    109603469
   04068 FoxO signaling pathway
    109603469
   04150 mTOR signaling pathway
    109603469
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    109603469
  09143 Cell growth and death
   04214 Apoptosis - fly
    109603469
 09150 Organismal Systems
  09158 Development and regeneration
   04320 Dorso-ventral axis formation
    109603469
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:atd01001]
    109603469
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:atd03036]
    109603469
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:atd04147]
    109603469
Enzymes [BR:atd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     109603469
Protein kinases [BR:atd01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   109603469
Chromosome and associated proteins [BR:atd03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     109603469
Exosome [BR:atd04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   109603469
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH YukC Choline_kinase Kdo
Other DBs
NCBI-GeneID: 109603469
NCBI-ProteinID: XP_019875529
LinkDB
Position
Unknown
AA seq 370 aa
MAESTGVSAANPNAEIVRGQLFEVGPRYTNLAYIGEGAYGMVVSAFDTVTKTKVAIKKIS
PFEHQTYCQRTLREIKILTRFKHENIIDIRDILRAVTIDQMKDVYIVQCLMETDLYKLLK
TQRLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPD
HDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLANRPIFPGKHYLDQL
NHILGVLGSPSADDLNCIINEKARSYLQSLPFRPKVPWVKLYPNADPKALDLLDKMLTFN
PHKRIEVEQALAHPYLEQYYDPADEPTAETPFRFDTELDDLPKDTLKRLIFEETLLYKQR
QQQEHGMETS
NT seq 1113 nt   +upstreamnt  +downstreamnt
atggcggaatctacaggtgtatctgctgcaaatccgaacgccgaaatagtcaggggccaa
cttttcgaagtgggaccccgctacaccaacctggcctatattggggagggcgcttacgga
atggtcgtatcggcatttgacacagtgacaaaaacaaaagtggccatcaagaaaatatca
cctttcgaacatcagacatattgccaaaggacattgagggaaatcaaaatactcacaagg
ttcaaacatgagaacataatcgatataagggatatactgcgggcggtaacgatagaccaa
atgaaggatgtgtatattgtacaatgtctgatggagactgatctttacaaactcttaaaa
acgcagagactgagtaacgaccacatatgttacttcctctaccagatacttcgggggctg
aaatacatacactcggcgaacgtacttcacagggatctgaagcccagcaacctgttactc
aacacaacctgcgaccttaaaatctgtgattttggattggccagagtggcagatccagac
cacgaccacaccggcttcctgacagagtacgtggcgaccagatggtaccgggccccggaa
atcatgctgaactccaagggctacaccaagtccatcgatatatggtcggtcggatgtatc
ctggccgagatgttggccaaccgacccattttcccgggcaaacactatctagatcagctc
aaccacatcctcggtgtgctgggatctccgtcagccgatgaccttaactgcatcattaac
gaaaaggctagaagttaccttcaatcgttaccgttcagaccaaaggtaccatgggttaaa
ctctatccaaacgccgatccaaaagccctggatctgctagataagatgttaacgttcaat
ccacataagagaattgaagtcgaacaagctctcgcccatccttatcttgagcaatactac
gatcccgccgatgagcccacagctgagactcccttccgattcgataccgagttagacgac
ctgcccaaggacacactgaaaaggttaatttttgaggaaacactcctatataagcaaaga
caacagcaagaacatgggatggagacttcataa

DBGET integrated database retrieval system