KEGG   Aethina tumida (small hive beetle): 109608543
Entry
109608543         CDS       T06105                                 

Definition
(RefSeq) cyclin-dependent kinase 2-like
  KO
K02206  cyclin-dependent kinase 2 [EC:2.7.11.22]
Organism
atd  Aethina tumida (small hive beetle)
Pathway
atd04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:atd00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    109608543
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:atd01001]
    109608543
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:atd03032]
    109608543
   03036 Chromosome and associated proteins [BR:atd03036]
    109608543
Enzymes [BR:atd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     109608543
Protein kinases [BR:atd01001]
 Serine/threonine kinases: CMGC group
  CDK family
   109608543
DNA replication proteins [BR:atd03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    109608543
Chromosome and associated proteins [BR:atd03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    109608543
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Kdo APH RIO1 Seadorna_VP7 Haspin_kinase FTA2
Other DBs
NCBI-GeneID: 109608543
NCBI-ProteinID: XP_019880544
LinkDB
Position
Unknown
AA seq 317 aa
MDKLDRFIRLGTAGEGTYGVVYKARNKLTGKKVALKRIKLEKFYQSGDSEGVPSTAIREI
CLLKGLRHSSIVELLDVMYTTDKLMLVFEYLDLDLKRYLDYTKKPVEKELARSYMKQLME
AMAYLHSHRILHRDLKPQNLLVDKEGHVKLADFGLSRSFSLPTRTYTHEVVTMWYRAPEL
LLGTKMYCTGIDIWSLGCIMAEILNKKALFPGDSEIDQLYKIFKIMGTPTEEMWPGVSLF
PDFKPSFPTWYPQNFRDCVNFHDDEEQEFLEMMLNYDPTKRKTAKELLKTNYIKKAKLTA
PEMEAFPVEKNDEESSE
NT seq 954 nt   +upstreamnt  +downstreamnt
atggacaagctggaccggtttataaggctgggaacggccggcgaaggcacctacggtgtc
gtttacaaggcaagaaacaaactaactggcaaaaaagtcgcgctgaaacgaatcaaattg
gagaaattctatcaaagtggtgactcagaaggcgttccttccacagcgattcgtgaaata
tgtcttttaaaaggtctaagacactcatcaatagtggaacttttggacgtcatgtacaca
acagacaaactaatgcttgtctttgaatatttagatctggatttgaaacgatatcttgat
tacacaaaaaagccagttgaaaaagaactagcacgaagttatatgaaacaactaatggaa
gcaatggcatatttacactctcacagaattttacatagagatttgaagccgcaaaattta
ctggtggacaaagagggccatgtaaaacttgctgattttggtttgtccaggtcattttca
ctccccacccgaacttacacacatgaggtggtgaccatgtggtacagggcgcccgaactt
cttctgggtacgaaaatgtactgcactggaattgatatttggagccttggttgtataatg
gcagaaattttgaataagaaagcattgttccctggggactctgaaattgatcaactttac
aaaatttttaaaataatgggtacacctactgaagagatgtggccgggagtttctttgttt
cctgatttcaaaccgtcatttccgacgtggtatccacagaattttcgcgactgcgttaac
tttcatgatgatgaagaacaggaatttttagagatgatgctcaattatgatccaactaaa
aggaagactgcaaaggaattattgaagactaactatattaaaaaggcaaaactaacggct
cccgagatggaagcttttcccgtagagaaaaacgatgaagaatcttcagaataa

DBGET integrated database retrieval system