KEGG   Caldicellulosiruptor bescii: Athe_1678Help
Entry
Athe_1678         CDS       T00857                                 

Definition
(GenBank) conserved hypothetical protein
Organism
ate  Caldicellulosiruptor bescii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: zinc-ribbons_6 HypA zf-C4pol FYVE NOB1_Zn_bind HTH_24 DUF35_N DZR zinc_ribbon_2 RecR MTHFR_C zf-ribbon_3
Motif
Other DBs
NCBI-ProteinID: ACM60772
UniProt: B9MKB4
LinkDB All DBs
Position
complement(1768299..1768739)
Genome map
AA seq 146 aa AA seqDB search
MDVRNCRRCGKIYLYDGSPICPQCRKEEEEDFKKVKEYLYDHPGATLPEVSNATGVSPEK
ILRFLKEERLEIVGESNIILECERCGKAIKTGRLCDECKKEVGTRFLSYLDDKKLQESKK
KNEEFAKRKEAGYRYLSKELKEDENK
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atggatgtcagaaactgtcgaagatgtggtaaaatttatctttatgatggaagtcctatt
tgtcctcaatgcagaaaagaggaagaagaggatttcaaaaaagtgaaagagtatctttat
gatcatcccggtgcaaccttgccagaagtatcaaacgcaacaggcgtgtcacctgaaaag
attttaaggtttttaaaagaggaaagacttgagattgtgggtgagagcaatatcatttta
gaatgtgaaagatgtgggaaggcaattaaaacaggaaggctttgtgatgagtgtaaaaaa
gaggttggaacaaggtttttgagttatcttgacgacaaaaagcttcaagaatcgaaaaag
aaaaatgaagagtttgcaaaaagaaaagaagcaggttacaggtatctttcgaaggagtta
aaagaagatgagaacaagtga

DBGET integrated database retrieval system