KEGG   Caldicellulosiruptor bescii: Athe_2039Help
Entry
Athe_2039         CDS       T00857                                 

Definition
(GenBank) D-alanine/D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
ate  Caldicellulosiruptor bescii
Pathway
ate00473  D-Alanine metabolism
ate00550  Peptidoglycan biosynthesis
ate01100  Metabolic pathways
ate01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ate00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Athe_2039
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Athe_2039
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    Athe_2039
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ate01011]
    Athe_2039
Enzymes [BR:ate01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Athe_2039
Peptidoglycan biosynthesis and degradation proteins [BR:ate01011]
 Precursor biosynthesis
  Amino acid ligase
   Athe_2039
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 RimK ATP-grasp_4 ATP-grasp_3 ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: ACM61116
UniProt: B9MLC6
LinkDB All DBs
Position
complement(2153766..2154860)
Genome map
AA seq 364 aa AA seqDB search
MTKLKVAVLFGGVSTEHEISIVSAKSIMQNMDKEKYEVIPIGITKEGKWLLYTGKIEDLD
SKWTQFSIECFVSPDRTKKALVKVKDNEATFIDIDVVFPVLHGLNGEDGTVQGLLELSGI
PYVGCGVLSSAICMDKAFAKKLALLEGIPQGHFLVVYKNEYSAKKDYFIRRIESEFSYPV
FVKPANSGSSVGISKAKDREDLVLAIHEAFLYDTKILIEQAINAREIECAVLGNDEVFVS
EPGEIIPSREFYSYEAKYIDNSSELIIPARLPKEVTEEIKDLAGRIYKIFECCGMARVDF
FVDKDTNKVYFNEVNTIPGFTSISMYPKLMEFSGIPYSQLIDKLISLAIEKNRQKKSIKY
SKEG
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgaccaagttaaaagttgctgttttatttggaggagtttcaacagaacacgaaatatcc
atagtttcggcaaaatcaattatgcaaaatatggacaaagaaaaatacgaagtaattcca
ataggtataacaaaagaaggaaaatggctcttgtacacaggcaaaattgaagatttggat
agcaagtggactcagttttctatagaatgttttgtctctcctgatagaaccaaaaaggca
cttgtaaaagtaaaagataacgaggctactttcatcgacattgatgtggtattcccggtt
ttgcatggactgaatggtgaggacgggacagttcagggacttttagagctctctggcata
ccatatgtaggatgcggtgttctttcgtcggctatatgcatggacaaagcgtttgctaaa
aagcttgcgcttttagaaggaataccacaggggcattttttggttgtatacaaaaacgaa
tattcagctaaaaaagattatttcataagaagaatagagagtgagttttcgtatcctgtt
tttgtaaagcctgcaaactcaggctcgtctgtgggtatatcaaaagcgaaagatagagaa
gaccttgttttggcaatacatgaggcttttttgtatgatacaaagattttgattgaacag
gctataaacgctcgggagatagaatgtgcagttttgggaaatgatgaggtatttgtgtct
gagccgggagaaataattccgtcaagagagttttattcgtatgaggcaaaatatattgat
aattcatcagagctcatcatcccggcaagacttccaaaggaagttactgaagaaataaaa
gatttggcaggaaggatttacaagatttttgagtgctgtggaatggcaagagtggacttt
tttgttgataaagatacgaacaaagtgtatttcaacgaggtaaacacaatacctggtttt
acaagtatttcgatgtatccaaaacttatggagttcagtggcattccatattctcaactc
attgataaactaatttctcttgccattgagaaaaatagacagaaaaaaagcataaaatac
agcaaagagggctga

DBGET integrated database retrieval system