KEGG   Caldicellulosiruptor bescii: Athe_2084Help
Entry
Athe_2084         CDS       T00857                                 

Definition
(GenBank) fumarate reductase/succinate dehydrogenase flavoprotein domain protein
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
ate  Caldicellulosiruptor bescii
Pathway
ate00020  Citrate cycle (TCA cycle)
ate00190  Oxidative phosphorylation
ate00650  Butanoate metabolism
ate01100  Metabolic pathways
ate01110  Biosynthesis of secondary metabolites
ate01120  Microbial metabolism in diverse environments
ate01130  Biosynthesis of antibiotics
ate01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ate00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Athe_2084
   00650 Butanoate metabolism
    Athe_2084
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Athe_2084
Enzymes [BR:ate01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Athe_2084
    1.3.5.4  fumarate reductase (quinol)
     Athe_2084
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA DUF5517
Motif
Other DBs
NCBI-ProteinID: ACM61161
UniProt: B9MLH1
LinkDB All DBs
Position
complement(2206134..2207939)
Genome map
AA seq 601 aa AA seqDB search
MIYKADVLVVGSGGAGLRAAIAACERAYESRKRIKVLLASKGKIGSCGTTALAYSDRMAF
HVTLPTTEPKGEDNWKYHAKDIYEIGGLVSDYDLAEILAKNSADAYFYLDSLGVPFVKEN
GVPAQFVTDGSIYARACFTGPDTAVQIEKALIRKLGEMKDIEVLEDVMISDLIVVNNKVC
GAIAFKGNQNIIILAKAIVLATGGAGSIYKSNVFPPRMTGDGYAMALRAGALLVNMEFIQ
IGLSSPKTKLACSGSIMRCVPRFVNEKGEEFLLNYPIAYNDVFEKGATWPISYEHKTCLI
DIAVFREIARGGKVFLDFTQNPKGFEFKHLREDLKQRYYSEVKNLTNKRSTPYERLCEIN
PQTVEWFLKRGIDLRNQMLEIAPSIQHFQGGVKIRENANTAISGLYACGECAGGQHGANR
PGGNALLDTQVFGKIAGESSFEFASNTSIDEESAISEANRLFESYKIYIAEDGIDLENAI
SELNRVMDLYASVVRHQDGLQKALMKIEELKTRKIKPVEYEYLLELKNMLLCAEAVVKSC
ILRDESRGPHLMFENYSDLWPKPRDERYNIYHVCKLNKETNQVEVFPMEPVKPETLGGKV
K
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
gtgatatacaaagcagatgtgctggtagtaggtagtggcggagcaggtttgagagctgca
attgcagcgtgtgaaagagcatatgagagccgaaaaagaataaaagttttgctggcaagt
aaaggaaaaataggaagttgtggtactacagctcttgcatactctgatagaatggcattc
catgtcacacttcccacaacagagcctaaaggtgaagataactggaaatatcatgcaaaa
gatatctatgagattggcggacttgtttctgattatgacttggctgagattttagcaaaa
aactcagccgatgcttatttttacttagatagtctcggtgttccgtttgtaaaagaaaat
ggcgtacctgctcaatttgtgacagacggttctatatatgcgcgtgcatgttttacagga
cctgatactgctgttcaaatagaaaaggctttgattcgaaagcttggtgagatgaaggat
attgaagttttagaagatgtgatgataagtgatttgattgttgtgaataacaaagtttgc
ggagcaattgcttttaaagggaatcaaaatatcataatacttgcaaaagccattgtttta
gcaacaggtggggcaggaagtatttataaaagcaatgtgtttccaccacgcatgacaggt
gatgggtatgcaatggcacttcgtgcaggggctttgcttgtgaatatggagtttattcaa
ataggtctttcatcccccaaaacaaaacttgcgtgttcaggaagtataatgagatgtgtc
cccaggtttgtaaatgaaaaaggagaagaatttttattaaattatcctatcgcgtacaat
gatgtatttgaaaaaggtgcaacgtggccaataagctacgagcacaagacatgtttgata
gacattgcagtgttcagagagattgcccgtgggggtaaagtgtttttagactttactcaa
aatccaaaaggttttgaatttaaacacctaagagaagacttaaaacaaagatattactca
gaagttaaaaatcttacaaataaaagatctactccatacgaaagactttgtgaaataaat
cctcagacagttgagtggtttttgaaaagaggaattgaccttagaaaccaaatgttagaa
attgcgccatcaattcagcatttccagggtggtgtaaaaattagagaaaatgcaaataca
gcaattagtggcttgtatgcctgtggcgagtgtgcaggcggacagcatggagcaaacaga
ccaggcggaaatgcacttttggatactcaggtttttggtaagatagcaggggaaagtagc
tttgaatttgcctcaaacacttcgattgatgaagaatctgcaatttctgaagcaaaccgc
ctgtttgaaagctataaaatctatatagctgaagatggcattgatttggagaatgctata
tcagaactaaatagggttatggatttgtacgcaagtgttgtgagacatcaggatggactt
caaaaagcacttatgaaaattgaggagttgaaaacaagaaaaatcaagcctgttgagtat
gaatatcttttagagctaaaaaacatgcttttgtgtgcagaggcagtggtaaaaagttgc
attttaagagatgaaagcagaggaccgcacttgatgttcgaaaattacagcgatttgtgg
ccaaagccaagagatgaaagatacaacatatatcacgtatgcaagctaaacaaagagaca
aatcaagttgaagtctttcctatggaaccagtaaaacccgaaaccttagggggcaaagta
aaatga

DBGET integrated database retrieval system