KEGG   Caldicellulosiruptor bescii: Athe_2767Help
Entry
Athe_2767         CDS       T00857                                 

Definition
(GenBank) germination protein, Ger(x)C family
Organism
ate  Caldicellulosiruptor bescii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Spore_GerAC
Motif
Other DBs
NCBI-ProteinID: ACM61819
UniProt: B9MQG2
LinkDB All DBs
Position
2917950..2919074
Genome map
AA seq 374 aa AA seqDB search
MKKFVFYLTLILLTLAFLTGCWNRKELNDILIVQAVGIDKNQSGQFKLTYQVLKPKVLKT
PTNIPSSFQQKGVWCFSSTGKSIFDAIRNTTLSSDKKLFFSHNKIIVISEKVAHQGIENV
LDIFLRYHEFRPDAYLIVTSDDIEKFLNSNVPIESIPAKELENVIKNYFANSKTLPISIY
EFQKMSNTKSKTAPVPFVTIKSPLKQSSQSQMFYVEKMAVFSNYKLVGYLTHEELRGLLW
AAGKIKRGIYPIKLGKDIFSLELIQSRSNINVKRKLGKAFFILQITTETNLGEKYSNSYI
SSSLVEKTKKEFSKSIRNDVQKVLKKSFELNCDILHLGDIYYSSYKKPLNFDKNSISVSI
VVKPFIRRFGMMKE
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagtttgtattttatttaacactgattttattaacattagcctttctgacaggt
tgctggaatagaaaagaactcaacgatatattgattgttcaggcagttggaattgacaaa
aaccaaagtggacagttcaaactcacatatcaggtattaaaaccaaaggtgctcaaaact
ccgacaaatataccttccagttttcagcaaaaaggagtgtggtgtttttcttcaacaggc
aaaagcatatttgatgctattcgaaatacaacactttcgtcagacaaaaaacttttcttt
tcacacaacaagattattgttattagcgaaaaagttgcacatcaaggaattgaaaatgtt
cttgacatattcttaagatatcatgaatttcgtccagatgcgtatctaattgttacttca
gatgacatcgaaaaattcttaaattcaaatgtcccaatagagtcaatacctgcaaaagaa
cttgaaaatgtaataaaaaattattttgcaaactcaaaaacgcttcctattagcatatat
gagtttcaaaagatgtcaaatactaagtcaaaaactgcacctgtcccatttgtgacaata
aaatcaccattaaaacaatcttcacaatcccagatgttttatgtagaaaaaatggctgtg
tttagcaactataaactagtagggtatcttacacacgaggagttaagaggacttttgtgg
gcagctggtaaaataaaaagagggatatatcctataaagcttggaaaagacatattttct
ttagaacttattcaaagcaggagcaacatcaatgttaaaagaaaacttggcaaagctttt
ttcatcctgcaaataaccacagagacaaaccttggtgaaaaatattcaaactcttatatc
tcaagttcattggttgaaaaaacaaaaaaagagtttagtaaatctatcagaaacgatgtt
cagaaggtattgaaaaaatcgtttgaactcaattgcgatattctgcaccttggcgatatt
tattactcttcatacaaaaagcctttaaattttgacaaaaattctatttcggtctcaatt
gttgtaaagcctttcataaggcgatttggtatgatgaaagaatga

DBGET integrated database retrieval system