KEGG   Agrobacterium tumefaciens Ach5: Ach5_07950Help
Entry
Ach5_07950        CDS       T03816                                 

Gene name
sodBI
Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
atf  Agrobacterium tumefaciens Ach5
Brite
Enzymes [BR:atf01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Ach5_07950 (sodBI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AKC06574
UniProt: A0A1B9UAH8
LinkDB All DBs
Position
circular:831416..832018
Genome map
AA seq 200 aa AA seqDB search
MAFELPELPYDYDALAPYMSRETLEFHHDKHHKAYVDNGNKLAAEAGLSDLSLEEVVKKS
FGTNAGLFNNAAQHYNHVHFWKWLKKDGGGNKLPGKLEQAFASDLGGYDKFKADFIAAGT
TQFGSGWAWVSVKNGKLEISKTPNGENPLVHGAEPILGVDVWEHSYYIDYRNLRPKYLEA
FVDNLINWDYVLERYEAASK
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggccttcgaacttcctgaactcccctacgactacgacgcgcttgcaccatacatgtcg
cgcgagacgctcgagttccatcacgacaagcaccacaaggcatatgtcgacaacggcaac
aagctggcggcggaagccggtctttccgacctttcgcttgaggaagtcgtgaagaagtcc
tttggcaccaatgctggtctcttcaacaatgctgcccagcattacaaccacgtccatttc
tggaagtggctgaagaaggacggcggcggcaacaagctgccgggcaagctggaacaggca
ttcgcctccgatctcggcggttacgacaagttcaaggctgatttcatcgctgccggcacc
acgcagttcggctccggctgggcatgggtttccgtcaagaacggcaagctcgaaatctcc
aagaccccgaacggcgaaaacccgctggttcatggtgcagaaccgatcctcggcgtcgac
gtatgggaacactcctactacatcgactaccgcaacctgcgtccgaagtacctcgaagcc
ttcgtcgacaacctcatcaactgggactacgtcctggagcgttacgaagccgcttccaag
taa

DBGET integrated database retrieval system