KEGG   Agrobacterium tumefaciens Ach5: Ach5_16770Help
Entry
Ach5_16770        CDS       T03816                                 

Gene name
hisI
Definition
(GenBank) phosphoribosyl c-AMP cyclohydrolase
  KO
K01496  phosphoribosyl-AMP cyclohydrolase [EC:3.5.4.19]
Organism
atf  Agrobacterium tumefaciens Ach5
Pathway
atf00340  Histidine metabolism
atf01100  Metabolic pathways
atf01110  Biosynthesis of secondary metabolites
atf01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:atf00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    Ach5_16770 (hisI)
Enzymes [BR:atf01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.19  phosphoribosyl-AMP cyclohydrolase
     Ach5_16770 (hisI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRA-CH
Motif
Other DBs
NCBI-ProteinID: AKC07453
LinkDB All DBs
Position
circular:1722965..1723417
Genome map
AA seq 150 aa AA seqDB search
MSISFPSAPADKEVLENSGLFSPKFDAHGLVTAVVTDARDGELLMVAHMNAQALSLTLET
GIAHYYSRSRDKIWKKGETSGNLQTVKEFRTDCDQDAVWLKVSVAGHDATCHTGRRSCFY
RTVELADGNAVTRITDDTRHFDPSTTYSGT
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atgtccatttcgtttccgtccgcgcctgcggacaaggaagtgcttgaaaattcaggtctc
ttctcaccgaaattcgatgcccacggccttgtcaccgccgtggtcaccgatgcgcgtgat
ggtgaattgctgatggtcgcccatatgaatgcgcaagccctgtcgctgacgctggaaacg
ggcatcgcccactattacagccgctcccgcgacaagatctggaaaaagggcgaaacctcc
ggcaacctgcagacggtgaaggaattccgtaccgattgcgatcaggacgccgtatggctg
aaggtctccgtcgccggtcatgacgcaacctgccatactggccgccgctcctgcttctac
cgcacggtcgagttggccgatggcaatgccgtcaccagaatcaccgacgatacccgccat
ttcgacccgtcgactacctattctggcacgtga

DBGET integrated database retrieval system