KEGG   Agrobacterium tumefaciens Ach5: Ach5_17920Help
Entry
Ach5_17920        CDS       T03816                                 

Gene name
gst
Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
atf  Agrobacterium tumefaciens Ach5
Pathway
atf00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:atf00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Ach5_17920 (gst)
Enzymes [BR:atf01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Ach5_17920 (gst)
Transporters [BR:atf02000]
 Other Transporters
  Pores ion channels [TC:1]
   Ach5_17920 (gst)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_2 GST_C GST_C_3
Motif
Other DBs
NCBI-ProteinID: AKC07568
UniProt: A0A1V2AF19
LinkDB All DBs
Position
circular:1835498..1836124
Genome map
AA seq 208 aa AA seqDB search
MSELIFYTNPMSRGRIARWMLEEVGVPYKTEILGFSTSMKSPAYRLINPMAKVPAIKHGD
TIVTEAAAICAYLADAFPGANLAPTPKARGLYYRWMFFAAGPLEMTTSMKAMGFEVPQEK
LRMAGCGSYADAINTLERAVSENRFIAGDHFTAADVYVGAHVGWGLQFGTIEKRPAFTDY
MAHLTDRPAFKRATQLDEAAAKDMQAAG
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaattgatcttctacaccaatcccatgtcgcgcggacgcattgcgcgatggatg
ctcgaggaagtgggcgttccctacaagacagagatactgggcttctcgacgtcgatgaaa
tcgccggcctatcggctgatcaacccgatggccaaggtgcccgccataaaacacggcgac
accattgtcaccgaagcggcagcgatctgcgcctatctggcggatgcctttccgggcgcc
aaccttgcgccgacgccgaaagcgcgcggactttattaccgctggatgttttttgctgcc
ggtccgttggaaatgacaaccagcatgaaggcgatgggtttcgaggtgccgcaggaaaag
ctgcgtatggctggctgcggcagctatgcggatgcgatcaacacgctcgaacgtgccgtc
agcgaaaaccgcttcatcgccggcgatcacttcactgcggcggatgtctatgtaggtgcc
catgtcggctggggcctgcagttcggcacaatcgaaaaacgtccggccttcacggactat
atggcgcatctgacagaccgccccgccttcaagcgggccacccagcttgacgaagcggca
gcgaaggatatgcaggcggccggttga

DBGET integrated database retrieval system