KEGG   Agrobacterium tumefaciens Ach5: Ach5_18570Help
Entry
Ach5_18570        CDS       T03816                                 

Definition
(GenBank) elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
atf  Agrobacterium tumefaciens Ach5
Brite
KEGG Orthology (KO) [BR:atf00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:atf03012]
    Ach5_18570
   03029 Mitochondrial biogenesis [BR:atf03029]
    Ach5_18570
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:atf04147]
    Ach5_18570
Translation factors [BR:atf03012]
 Eukaryotic Type
  Elongation factors
   Ach5_18570
 Prokaryotic Type
   Ach5_18570
Mitochondrial biogenesis [BR:atf03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Ach5_18570
Exosome [BR:atf04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Ach5_18570
  Exosomal proteins of breast cancer cells
   Ach5_18570
  Exosomal proteins of colorectal cancer cells
   Ach5_18570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: AKC07633
UniProt: A0A1B9U5C4
LinkDB All DBs
Position
circular:complement(1890322..1891497)
Genome map
AA seq 391 aa AA seqDB search
MAKSKFERNKPHVNIGTIGHVDHGKTSLTAAITKYFGEFKAYDQIDAAPEEKARGITIST
AHVEYETPNRHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHILLARQ
VGVPAIVVFLNKVDQVDDAELLELVELEVRELLSSYDFPGDDIPIVKGSALAALEDSDKK
IGEDAIRELMAAVDAYIPTPERPIDQPFLMPIEDVFSISGRGTVVTGRVERGIVKVGEEV
EIVGIRPTSKTTVTGVEMFRKLLDQGQAGDNIGALVRGVTRDGVERGQILCKPGSVKPHK
KFMAEAYILTKEEGGRHTPFFTNYRPQFYFRTTDVTGIVSLPEGTEMVMPGDNVTVEVEL
IVPIAMEEKLRFAIREGGRTVGAGIVASIVE
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagagcaagtttgagcgcaataagccgcacgtcaacattggcacgatcggtcac
gtcgaccacggcaagacgtcgttgactgctgcgatcacgaagtatttcggcgagttcaag
gcgtacgaccagatcgacgctgctcctgaagaaaaggctcgcggcatcacgatctcgacg
gcgcacgtcgaatacgaaacgccgaaccgtcactacgcacacgtcgactgccccggccac
gccgactacgtgaagaacatgatcaccggtgctgcccagatggacggcgcgatcctggtt
tgctctgcagctgacggcccgatgccgcagacgcgcgagcacatcctgcttgctcgccag
gttggcgttccggcgatcgtcgtgttcctcaacaaggttgaccaggttgacgacgccgag
cttctcgagctcgtcgaactggaagttcgcgaacttctgtcgtcctacgacttcccgggc
gacgatatcccgatcgtcaagggttcggcacttgctgctcttgaagattccgacaagaag
atcggtgaagacgcaatccgcgagctgatggctgctgttgacgcctacatcccgacgcct
gagcgtccgatcgaccagccgttcctgatgccgatcgaagacgtgttctcgatctctggc
cgtggtacggttgtgacgggtcgcgttgagcgcggtatcgtcaaggttggtgaagaagtc
gaaatcgtcggcattcgtccgacgtcgaagacgacggttaccggcgttgaaatgttccgc
aagctgctcgaccagggccaggctggcgacaacatcggtgctctggttcgcggcgttacc
cgtgacggcgttgagcgtggccagatcctgtgcaagccgggttcggtgaagccgcacaag
aagttcatggcagaagcctacatcctgacgaaggaagaaggcggccgtcatacgccgttc
ttcacgaactaccgtccgcagttctacttccgtacgactgacgttaccggtatcgtttcg
cttccagaaggcacggaaatggttatgcctggcgacaacgtcactgttgaagtcgagctg
atcgttccgatcgcgatggaagaaaagctgcgcttcgctatccgcgaaggcggccgtacc
gtcggcgccggcatcgtcgcttctatcgtcgagtaa

DBGET integrated database retrieval system