KEGG   Agrobacterium tumefaciens Ach5: Ach5_19780Help
Entry
Ach5_19780        CDS       T03816                                 

Gene name
ddlB
Definition
(GenBank) D-alanylalanine synthetase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
atf  Agrobacterium tumefaciens Ach5
Pathway
atf00473  D-Alanine metabolism
atf00550  Peptidoglycan biosynthesis
atf01100  Metabolic pathways
atf01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:atf00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Ach5_19780 (ddlB)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Ach5_19780 (ddlB)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    Ach5_19780 (ddlB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:atf01011]
    Ach5_19780 (ddlB)
Enzymes [BR:atf01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Ach5_19780 (ddlB)
Peptidoglycan biosynthesis and degradation proteins [BR:atf01011]
 Precursor biosynthesis
  Amino acid ligase
   Ach5_19780 (ddlB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 ATP-grasp_3 GARS_A CPSase_L_D2 Phage_Mu_Gp45
Motif
Other DBs
NCBI-ProteinID: AKC07754
UniProt: A0A3G2DKK7
LinkDB All DBs
Position
circular:complement(2017177..2018103)
Genome map
AA seq 308 aa AA seqDB search
MGGKHVAVLLGGFSSERPVSLSSGNACALALEGEGYKVTRVDVGRDIAAVLGELRPDVAF
NALHGPFGEDGTIQGILEYLAIPYTHSGVLASALAMDKAQAKKVAAAAGIPVADERVMNR
FEFTSEHPLAPPYVVKPVREGSSFGVVIVKEDQSHPPQILTSSEWRYGDQVMVERYIHGR
ELTCGVLNGEALGVTEVVPLGHNFYDYDAKYAAGGSKHVIPAEISPKIYQKIQTLAVMAH
RAIGCRGVSRSDFRYDDRFSEDGEVIWLEVNTQPGMTPTSLVPEMAAHAGRSFGNLVSWM
VEDASCLR
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgggcggcaagcacgtagctgttcttttgggtgggttttcgtcggagcggccggtcagc
ctctcgtccgggaacgcttgcgcgctcgcccttgagggcgaggggtacaaggtcacccgg
gtcgatgtggggcgcgatatcgccgccgtactcggcgagctgcgcccggatgtcgccttc
aatgcgctgcatggccccttcggtgaagacggcaccattcagggcattctcgaatatctc
gccattccctatacccattccggcgtgctcgcttctgcacttgccatggacaaggcgcag
gccaagaaagtggctgcggctgctggcattccggtggctgacgaacgcgtcatgaaccgg
ttcgaattcaccagcgaacatccgcttgcgccgccctacgtcgtcaagccggtgcgcgaa
ggctcgagcttcggtgtggtgatcgtcaaggaagaccagtcgcatccgccgcaaatcctt
acctcgtccgaatggcgttacggcgaccaagtcatggtcgagcgttacatccatggtcgc
gaactgacctgcggcgtgctcaacggcgaggcgctaggtgtgacggaagtggtgccgctg
ggtcacaatttctatgattatgacgctaaatacgcagccggtggctcaaagcatgtcatt
ccggcagaaatttcaccaaaaatttaccaaaaaattcaaacactggcggttatggcgcat
cgggcgatcgggtgccgtggcgtaagccgttcagactttcgttacgacgaccgcttctca
gaagatggcgaagttatctggcttgaagtgaatacgcagccgggcatgacgccgacctcc
ctggtgccggaaatggcggcccatgctggccgctcctttggtaaccttgtcagctggatg
gtggaggacgcttcgtgtttgcggtga

DBGET integrated database retrieval system