KEGG   Agrobacterium tumefaciens Ach5: Ach5_21590Help
Entry
Ach5_21590        CDS       T03816                                 

Gene name
tdk
Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
atf  Agrobacterium tumefaciens Ach5
Pathway
atf00240  Pyrimidine metabolism
atf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:atf00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    Ach5_21590 (tdk)
Enzymes [BR:atf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     Ach5_21590 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_30
Motif
Other DBs
NCBI-ProteinID: AKC07934
UniProt: A0A1B9TSB5
LinkDB All DBs
Position
circular:2214284..2214865
Genome map
AA seq 193 aa AA seqDB search
MAKLYFNYAAMNAGKSTMLLQASYNYHERGMRTLIFTAAFDDRAGFGRVASRIGLSSDAR
TFDANTDIFSEVEALHAEAPVACVFIDEANFLSEHHVWQLAGIADRLNIPVMAYGLRTDF
QGKLFPASRELLAIADELREIRTICHCGRKATMVARFDNEGNVVKEGAQIDVGGNEKYVS
FCRRHWVETVKGD
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaactctatttcaattatgcggcgatgaacgccggcaagtcgaccatgttgtta
caggcatcctataattatcacgagcgcggcatgcgcacgttgattttcacggccgccttt
gacgaccgggccggcttcggccgggtcgcgtcgcgcatcggcctgtcgtccgacgcacgg
accttcgacgcaaacaccgatatcttctccgaagtggaggccctgcatgccgaagcgccc
gttgcctgcgttttcatcgatgaagccaacttcctgtccgaacaccatgtctggcagctt
gccggtattgccgaccggttgaacattccggtgatggcctacggcctgcgcacggatttt
cagggcaagcttttcccggcctccagggaactgctcgccattgccgacgagcttcgcgaa
atccgcaccatctgccattgcggccgcaaggcgacgatggtcgcccgtttcgacaatgaa
ggaaatgtggtcaaggaaggcgcgcagatcgatgtcggcggcaacgaaaaatacgtctcc
ttctgccgccgccactgggtcgaaacggtcaagggcgactga

DBGET integrated database retrieval system