KEGG   Agrobacterium tumefaciens Ach5: Ach5_22170Help
Entry
Ach5_22170        CDS       T03816                                 

Definition
(GenBank) methyltransferase
Organism
atf  Agrobacterium tumefaciens Ach5
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_23 Methyltransf_25 Methyltransf_11 Methyltransf_12 Methyltransf_31 TehB
Motif
Other DBs
NCBI-ProteinID: AKC07992
UniProt: A0A3G2DK41
LinkDB All DBs
Position
circular:2277673..2278269
Genome map
AA seq 198 aa AA seqDB search
MAGRDDETIGFYTDNAGVYTSRGQTADLPHLEKFLSRLPKGATILELGCGGGQDSEFMLA
AGFDVRPTDGTPEIAKAAETRLGIPVATLLFEDICEVETYDGVWANACLLHVPRPALSGI
IRRIHAALKQGGVFYASFKAGEAEGRDTFGRYYNYPSKTWLEDLYRHFAWAGMAIEARHG
SGYDKLPTDWLHVTATKP
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atggccggcagagacgacgaaacgatcggcttttatacggataatgccggagtctatacg
tcgagagggcaaacggcggaccttccccatctggaaaaattcctgtcgcgcctgcccaaa
ggcgcgaccatcctcgaactggggtgcggtggcgggcaggacagtgaattcatgctcgct
gcaggcttcgatgtgcgcccgacggacggcacacccgaaatcgccaaggcggccgaaacg
cggctcggcattcccgtcgcgacattgctgttcgaagatatctgcgaggtggagacttat
gacggcgtgtgggccaatgcctgcctgttgcatgtcccccgccccgctctttccggcatc
attcgccgcatccatgcggcgctgaaacagggcggtgttttttacgccagcttcaaggcc
ggagaagcggaaggccgcgacacgttcggccgctattacaactatccttcgaaaacctgg
cttgaggacctgtacaggcatttcgcctgggcaggcatggcgatagaagcacggcacggc
agcggttacgacaagctgccaaccgactggctgcatgtgacggcaacgaaaccctga

DBGET integrated database retrieval system