KEGG   Agrobacterium tumefaciens Ach5: Ach5_25270Help
Entry
Ach5_25270        CDS       T03816                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase iron-sulfur
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
atf  Agrobacterium tumefaciens Ach5
Pathway
atf00020  Citrate cycle (TCA cycle)
atf00190  Oxidative phosphorylation
atf00650  Butanoate metabolism
atf01100  Metabolic pathways
atf01110  Biosynthesis of secondary metabolites
atf01120  Microbial metabolism in diverse environments
atf01130  Biosynthesis of antibiotics
atf01200  Carbon metabolism
Module
atf_M00009  Citrate cycle (TCA cycle, Krebs cycle)
atf_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
atf_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:atf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Ach5_25270 (sdhB)
   00650 Butanoate metabolism
    Ach5_25270 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Ach5_25270 (sdhB)
Enzymes [BR:atf01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Ach5_25270 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     Ach5_25270 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_9 Fer2 Fer4_7
Motif
Other DBs
NCBI-ProteinID: AKC08302
UniProt: A0A1B9TMH9
LinkDB All DBs
Position
circular:complement(2619957..2620736)
Genome map
AA seq 259 aa AA seqDB search
MVELALPKNSQISEGKVWPKPDGAKNVREYRIYRWNPDDGQNPRIDTYYIDIDDCGPMVL
DALLYIKNNIDPTLTLRRSCREGICGSCAMNIDGTNTLACTKGMEEIKGTVKVYPLPHMP
VVKDLVPDLSNFYAQHRSIEPWLKTVSPTPAKEWKQSHEDRLKLDGLYECILCACCSTSC
PSYWWNGDRYLGPAVLLQAYRWLIDSRDEATGERLDDLEDPFRLYRCHTIMNCAQACPKG
LNPAKAIAEIKKMMVERRV
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggttgaactcgctctccccaagaattcccagatcagcgaaggcaaagtctggccgaag
ccggatggtgccaagaacgttcgcgaataccggatctatcgctggaacccggatgatggc
cagaacccgcgcatcgatacctattatatcgatatcgacgattgcgggccgatggttctc
gatgcgctgctgtacatcaagaacaatatcgacccgacgctgacgctgcgccgctcctgc
cgtgaaggcatttgcggttcctgcgctatgaacatcgacggcaccaacacgctcgcctgc
accaagggcatggaagagatcaagggaacggtgaaggtctatccgctgccgcatatgcca
gtggtgaaggacctcgttccggacctgtcgaacttctacgcgcagcaccgctccatcgag
ccgtggctgaagacggtttcgccgacgcctgccaaggaatggaagcagagccatgaggac
cgcctgaagctcgacggtctctacgagtgcattctgtgcgcctgctgctccacttcctgt
cccagctactggtggaacggcgaccgttacctcggccccgccgttctgctgcaagcctat
cgctggctgatcgacagccgcgacgaagcaaccggcgaacgtcttgatgatctcgaagat
ccgttccgtctttatcgctgccacaccatcatgaactgcgcgcaggcttgcccgaagggt
ctcaacccggccaaggcgatcgcggaaatcaagaagatgatggtcgagcgtcgcgtctga

DBGET integrated database retrieval system