KEGG   Agrobacterium tumefaciens Ach5: Ach5_25280Help
Entry
Ach5_25280        CDS       T03816                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
atf  Agrobacterium tumefaciens Ach5
Pathway
atf00020  Citrate cycle (TCA cycle)
atf00190  Oxidative phosphorylation
atf00650  Butanoate metabolism
atf01100  Metabolic pathways
atf01110  Biosynthesis of secondary metabolites
atf01120  Microbial metabolism in diverse environments
atf01130  Biosynthesis of antibiotics
atf01200  Carbon metabolism
Module
atf_M00009  Citrate cycle (TCA cycle, Krebs cycle)
atf_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
atf_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:atf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Ach5_25280 (sdhA)
   00650 Butanoate metabolism
    Ach5_25280 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Ach5_25280 (sdhA)
Enzymes [BR:atf01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Ach5_25280 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     Ach5_25280 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA Pyr_redox_2 Thi4 DAO FAD_binding_3 HI0933_like
Motif
Other DBs
NCBI-ProteinID: AKC08303
UniProt: A0A1B9UMQ0
LinkDB All DBs
Position
circular:complement(2620752..2622593)
Genome map
AA seq 613 aa AA seqDB search
MASISSPSQNGKAYTYVDHSYDVIVVGAGGAGLRATLGMAEQGFRTACITKVFPTRSHTV
AAQGGIAASLTNMTPDCWQWHLYDTVKGSDWLGDVDAMQYLAMEAPKAVYELEHYGVPFS
RNAEGKIYQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQSLRNNAEFFIEYFA
LDLIMAPDGRCTGVVAWNLDDGTIHRFSAKMVVLATGGYGRAYFSATSAHTCTGDGGGMI
ARAGLPLQDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSEGERFMERYAPSAKDLASR
DVVSRCMTMEIREGRGVGKNKDHIFLHLDHLDPAILHERLPGISESAKIFAGVDVTREPI
PVLPTVHYNMGGIPTNYWGEVLNANAENPERIAPGLMAVGEAGCASVHGANRLGSNSLID
LVVFGRAAAIRAAQVIDRDAPVPALDTAACDKIMDRFDSLRYANGSTPTAVLRDKMQRAM
QDDAAVFRTQESLESGCQRISAIWKELPDVKVTDRSMVWNSDLVETLELHNLMANAITTV
YGAEARKESRGSHAREDFVDGPFGGRDDVNWRKHTLAWVSPEGDVKLDYRPVHTDLIADG
IDPKKIEPKARVY
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atggcatcgatcagttcaccttcccagaatggcaaggcttacacctacgtcgatcactcc
tatgacgtgatcgtggtgggcgccggcggcgcgggtctgcgcgcaacgctcggcatggcg
gaacaggggttccgcacggcctgcatcaccaaggttttcccgacgcgctcccacacggtc
gcggcgcagggcggcatcgccgcttctctcaccaacatgacgcccgactgttggcagtgg
cacctttacgacaccgtaaagggctccgactggctgggcgacgtcgacgcgatgcaatat
ctcgccatggaagcgccaaaggcggtctatgagctggagcattacggcgtgcccttctcg
cgcaatgccgagggcaagatctaccagcgcccgtttggcggccacatgcagaactacggc
gaaggcccgccggtgcagcgcacctgcgccgctgccgaccgtaccggccacgccattctg
cacacgctttatggccagtcgctgcgcaacaatgcggaattcttcatcgaatatttcgcg
ctcgatctcattatggcgcccgatggccgctgcaccggcgtcgtggcgtggaacctcgat
gacggcacgatccatcgcttctccgccaagatggtggtgctggcgaccggtggttacggc
cgcgcctatttctcggcgacctcggctcatacctgcaccggcgacggcggcggtatgatc
gcacgtgccggcctgccgcttcaggatatggaattcgttcagttccacccgaccggcatt
tacggcgcgggctgcctgatcaccgaaggcgcgcgcggcgagggcggttatctcgtcaac
tccgaaggcgagcgcttcatggagcgttatgctccttcggcgaaggaccttgcttcgcgt
gacgtggtgtctcgctgcatgacgatggaaatccgcgagggtcgtggcgtcggcaagaac
aaggaccacatcttcctgcatctcgatcaccttgatccggcgatcctgcacgagcgtctt
ccgggcatttccgaaagtgccaagattttcgccggcgttgacgtgacgcgcgagccgatc
ccggtcctgccgaccgttcactacaatatgggcggcattccgaccaactattggggcgaa
gtgctgaacgccaacgccgagaacccggaacgcatcgctcccggcctgatggccgttggc
gaagccggttgcgcctcggttcacggcgcgaaccgcctcggctccaactcgctgatcgac
cttgtggtcttcggccgcgctgccgccatccgtgcagcccaggtcatcgaccgcgatgcg
ccggttcctgctctcgacacggctgcctgcgacaagatcatggatcgcttcgacagcctg
cgttatgccaacggctcgacgccgacggcggtgctgcgtgacaagatgcagcgcgccatg
caggacgatgccgccgtattccgcacacaggaatcgctggaaagcggttgccagcgcatt
tccgccatctggaaggaactgcctgacgtcaaggttaccgaccgttcgatggtctggaac
tccgatctggtggaaacgctcgagctgcacaatctgatggccaacgcgatcaccacggtc
tatggcgcggaagcgcgcaaggaaagccgcggttcgcatgcccgtgaggatttcgtcgat
ggtccgttcggcggtcgcgacgacgtgaactggcgcaagcacacgcttgcctgggtcagc
cctgaaggtgatgtcaagctcgactaccgccctgttcacaccgacctgatcgccgacggc
atcgatccgaaaaagatcgagccgaaggctcgcgtctactga

DBGET integrated database retrieval system