KEGG   Agrobacterium tumefaciens Ach5: Ach5_28610Help
Entry
Ach5_28610        CDS       T03816                                 

Gene name
cga
Definition
(GenBank) glucoamylase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
atf  Agrobacterium tumefaciens Ach5
Pathway
atf00500  Starch and sucrose metabolism
atf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:atf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Ach5_28610 (cga)
Enzymes [BR:atf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     Ach5_28610 (cga)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucodextran_N Glyco_hydro_15
Motif
Other DBs
NCBI-ProteinID: AKC08634
LinkDB All DBs
Position
linear:complement(161280..163685)
Genome map
AA seq 801 aa AA seqDB search
MMRTGLDFAPGAPGIEARWTSSAKNGVGTALSEASPIWFTLSHGILNEVYYPRIDSACTR
DLGFVVTGPEGYFSEEKRDCVSVTRPFKSGIPAFHITNTATDGSFRIEKQVISDPARASV
LQQLSFIPLKGQISDYRVTALLAPHLVNAGNLNSAWIGDYEGHQVLFATGRSRYLALVCD
LPWRAVSAGFVGVSDGWQQLHRHGRIVEEYQRADDGNVSLAGEIDFSGVNGAATLALGFG
ETEYEAAAAAVYSLKHGFERAHEAYVANWRNWQDRLETLDRDTHHGINSYRVSTAVLAAH
RAADRPGAVVASLSIPWGASKSDDDLGGYHLVWPRDLVEAAGGFLAAGDHHEALAILNYL
RQVQQPSGRWPQNLWLDGKPYWPGVQMDECAFPILLADMLHRHGHLDHATRADFMPMIHR
AAAYILANGPTTGEDRWEEDAGYSPFTLAVEIAALLAAADLIDMDGDAAVAVHLRETADC
WNEQIEQWTFAGDETFCAALGISGHYVRIASPDATDVARPVGDTPIRNQTPDRSTLPTSD
VISPDALALVRFGLRAPDDPHILATIKAIDHCLRADLPQGPVWYRYTGDGYGEHADGAAF
DGTGQGRPWPLLTGERAHYELAAGRREVAEALLVTLEKSAGGNGLFPEQIWDQPDIPEYE
LFYGQPSGSAMPLVWAHAEHIKLLRSLADGSVFDMPPQGVERYIINKTPSHLRIWCFNNK
IAGIPAGKMLRLELTDDAVVHWSADGWVTTSDTRTIASGLGTYFVDLPVQDMAAGDAIVF
TFFWPNTGNWENQDFTVRLGE
NT seq 2406 nt NT seq  +upstreamnt  +downstreamnt
atgatgcgcaccggactggattttgcaccgggcgcgcctggcatagaagcgcgctggacg
tcgagcgccaaaaacggggtcggcactgcgctgtcggaagcatcgcctatctggttcacg
ctcagccacggcattctgaacgaggtctattatccgaggatagacagtgcctgcacccgc
gatctcggttttgttgtcactgggcctgagggttacttttccgaagaaaaacgcgactgc
gtatccgtcacccgcccttttaaaagtggaattccggcatttcacattaccaatacggcg
acggatggctcgttcagaatcgagaaacaggtgatcagcgatcccgcgcgggccagtgtt
cttcagcagctttcgttcattcccctgaagggacaaatttcggattatcgcgtgactgcg
ctgctggcacctcatctcgtcaatgcaggcaatcttaactcggcttggattggcgactat
gagggacatcaggtcctcttcgcgaccggccgttcacgatatcttgcgcttgtctgcgat
ctgccctggcgggcagtcagcgccggtttcgtgggtgtttccgatggttggcagcagttg
catcggcacggacgcatcgttgaagagtaccagcgagccgatgacggaaatgtctcgctg
gcaggtgagattgacttcagtggtgtcaatggcgcggcaacattggcgctcggctttggc
gagacggaatatgaagcggctgcggcggccgtttacagtctgaagcatggctttgaacgg
gcgcacgaggcctacgttgccaactggcgcaactggcaagaccggctggaaacgctcgac
cgcgatacgcatcacggcatcaattcctatcgggtgtcgacagcagtgctcgccgcacat
cgtgccgctgaccggcctggcgctgttgttgcaagcctgtcgatcccatggggagcatcg
aagagcgatgacgatctcggtggttatcatctggtctggccgcgcgatctggtggaagcg
gccggcggatttctggcggccggcgatcaccacgaggcgctggcgatcctcaattatctt
cgtcaggtgcagcagccatcgggtcgctggccgcaaaatctctggctggatggcaaaccc
tattggccgggcgtccagatggatgaatgcgcctttccgatcctgctggcggatatgctg
catcgacatggtcacctggatcatgccacgcgggcggattttatgccgatgatccaccgc
gccgcagcctatattctggcaaacggcccgacgaccggggaggacaggtgggaagaggat
gccggctacagtcccttcacccttgccgtcgagatcgctgcgctgcttgccgctgccgac
cttatcgatatggacggtgatgctgccgtagccgtacatctacgggaaacggctgattgc
tggaacgagcagatcgaacaatggacctttgccggtgacgagacattctgcgccgcgctt
ggcatttccggccactatgttcgcatcgcttcgcctgacgcgaccgacgtagctcgacca
gtcggcgatacgcccatccgcaaccagacgccggaccgttccacgctgccgaccagcgac
gtcatcagccccgatgcgcttgcccttgttcgcttcggcctgcgcgcgcctgacgatccg
catattctcgcgacgatcaaagcaatcgaccattgcctgcgtgccgatctgccgcagggg
cctgtatggtatagatatacgggagatggatatggtgagcacgccgatggagcagcattc
gacggcaccgggcaggggcggccatggccgcttttgaccggcgaacgcgcccattacgag
cttgctgcgggaaggcgggaggtggccgaagcgctgctggtaacgctggagaaatcggcc
ggtggaaacggccttttccccgagcagatctgggaccagcccgacatccccgaatacgag
cttttctacggccagccctcaggaagtgcgatgccgctggtctgggcgcatgctgaacat
atcaaacttctgcggtcgcttgcagatggttccgttttcgacatgcccccgcagggtgtg
gaacgctacatcatcaacaagacaccgtcgcaccttcggatctggtgtttcaataacaag
attgccgggataccggccggcaagatgttgcggctcgaactgacggatgatgctgtcgtg
cactggagtgcggatggctgggtgacgaccagcgacaccagaacgattgcttccggcctt
ggcacatatttcgtcgacttgcccgttcaggatatggcggcgggcgacgcaatcgttttt
actttcttttggccaaacacagggaattgggaaaaccaggatttcaccgttcgcctcggc
gaatga

DBGET integrated database retrieval system