KEGG   Agrobacterium tumefaciens Ach5: Ach5_33730Help
Entry
Ach5_33730        CDS       T03816                                 

Definition
(GenBank) MutT family NTP pyrophosphatase
  KO
K03574  8-oxo-dGTP diphosphatase [EC:3.6.1.55]
Organism
atf  Agrobacterium tumefaciens Ach5
Brite
KEGG Orthology (KO) [BR:atf00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:atf03400]
    Ach5_33730
Enzymes [BR:atf01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.55  8-oxo-dGTP diphosphatase
     Ach5_33730
DNA repair and recombination proteins [BR:atf03400]
 Eukaryotic Type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    Ach5_33730
 Prokaryotic Type
    Ach5_33730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NUDIX_4 NUDIX NUDIX_2
Motif
Other DBs
NCBI-ProteinID: AKC09146
UniProt: A0A1B9UR84
LinkDB All DBs
Position
linear:complement(736301..736714)
Genome map
AA seq 137 aa AA seqDB search
MSEAGKKILLVAACALLDQDGRILLAQRPEGKSLAGLWEFPGGKVEQGETPEETLVRELD
EELGIKTKIACLAPLTFASHTYETFHLLMPLYVCRRYEGMAHGREGQAIKWVKPQALRDY
PMPPADEPLIPFLQDLL
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaagcgggcaaaaaaatcctgctggttgccgcctgcgcccttcttgatcaggac
ggccgtattcttctggcgcaacgacctgagggcaagtcgctcgccggcctgtgggaattt
ccaggcggcaaggtggaacaaggcgaaacaccggaggagaccctcgtccgcgagctggac
gaggagctgggtatcaagaccaagatagcctgcctcgcgccgctgacgttcgccagccat
acctacgagacttttcacctgctgatgccgctttacgtgtgccgtcgttatgaaggcatg
gcccatgggcgcgaaggacaggcaattaaatgggtaaagccgcaggctctgcgtgattat
ccgatgccgccggccgacgagccgctcatccccttccttcaggatttgctttaa

DBGET integrated database retrieval system