KEGG   Agrobacterium tumefaciens Ach5: Ach5_34260Help
Entry
Ach5_34260        CDS       T03816                                 

Gene name
glpA
Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
atf  Agrobacterium tumefaciens Ach5
Pathway
atf00564  Glycerophospholipid metabolism
atf01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:atf00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Ach5_34260 (glpA)
Enzymes [BR:atf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Ach5_34260 (glpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C STPPase_N FAD_oxidored Pyr_redox_2 FAD_binding_2 NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AKC09199
UniProt: A0A3B8FHT4
LinkDB All DBs
Position
linear:complement(796005..797579)
Genome map
AA seq 524 aa AA seqDB search
MVPGAVLRGPMSGENIFDLFVIGGGVNGCGIARDAVGRGYSVALAEKGDFASGTSSAATK
LIHGGLRYLEHYEFRLVREALMEREILWAMAPHVIWPMRFVLPLQKGGVRPAWMVRLGLF
LYDNLGGRKLLPPTRTVDLRQDPAGKPLKPVFAKAFEYSDGWVDDARFVVLNARDAADRG
ATIMNRTRVVSARREGGLWLIVTLDEKTGRSATHRARMLVNAAGPWVDNVLSGVFGRNDV
HNVRLVQGSHIIVRRKFSDPRAYFFQNPDNRIIFAIPYEQDFTLIGTTDRDYKGDPAKVR
ISEEEISYLCNAASEYFSEPVKPDDIVWTYSGVRPLFDDGASKAQEATRDYVLKVEEAEG
EAPLLNIFGGKLTTYRRLAEHALEKIGAAIGEKGKPWTAGSYLPGGDFGVERYDAQVRAL
VSRYPFLDGRHAERLIKNYGTKAAELLGVATDVSGLGRHFGGTLYECEVRWLVEHEWAFA
AEDILWRRTKQGLRLSRDEAAALDEFVSTLTGVKEKGEAVTEQA
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atggtccccggcgctgtcttgcgaggccctatgtccggcgaaaacatattcgatcttttt
gtcatcggcggtggcgtgaatggttgcggcattgcccgcgatgccgtgggtaggggctat
tccgtggcgcttgcggaaaagggcgattttgcctccggtacgtcttcggcagccaccaag
ctcatccatggcggcctgcgttatctcgaacattatgagtttcgtctggtgcgagaagcc
ttgatggagcgtgaaattctgtgggccatggccccgcacgtcatctggcccatgcgcttc
gtcctgccgctccagaaaggcggcgtgcgtccggcatggatggtccggcttggcctcttt
ctttatgacaacctcggcggccgcaagcttttgccgccgacgcgcacggtcgatcttcgg
caagacccggcaggcaaacctctgaagccggtctttgccaaggctttcgaatattccgac
ggctgggtggacgatgcccgtttcgtggttctgaatgcgcgtgacgcggcggatcgcggt
gcgacgatcatgaaccgcacgcgggtcgtttccgcacggcgcgaaggcggcttgtggctt
atcgtgacgctggacgaaaagaccggtcgttcagccacgcacagagcgcgcatgctggtg
aatgccgctggcccatgggtggataacgtgctgtccggcgtgttcggccgcaacgatgtg
cacaatgttcgtctcgtgcagggcagccacatcatcgtgcgcaggaagttttccgatccg
cgcgcctatttcttccagaacccggacaaccgcatcatcttcgccattccctatgagcaa
gattttacgctgatcggcaccacggaccgcgactacaagggcgatccggccaaggtgcgc
atctccgaggaagagatttcctatctctgtaatgccgccagcgaatatttcagcgagccg
gtgaagccggatgatatcgtctggacctattccggcgtgcgcccgcttttcgatgatggc
gcttcaaaggcgcaggaagccacacgcgactatgtgctgaaggttgaagaggcagagggc
gaagcgccgctgctcaatatcttcggcggcaagctgaccacctaccggcggctggcggaa
catgctctggaaaagatcggcgcagccatcggagaaaagggcaagccctggacggcgggc
tcgtatctgccgggcggtgacttcggggtggagagatatgacgcccaggtgagggcgctt
gtctcccgttacccattccttgatggacgccatgccgagcggctcatcaaaaactacggc
acgaaggctgcggaactgctcggtgtcgccaccgatgtttccggcctcggccggcatttc
ggcggcacactttatgaatgcgaagtgcgctggctggtggaacacgaatgggcctttgca
gccgaggatattctctggcggcgcactaaacagggcctgcggttgagcagggacgaggct
gccgctctggatgaattcgtttccacgctgactggtgtcaaggaaaagggcgaagccgtg
acggagcaggcctga

DBGET integrated database retrieval system