KEGG   Agrobacterium tumefaciens Ach5: Ach5_41250Help
Entry
Ach5_41250        CDS       T03816                                 

Gene name
adeC
Definition
(GenBank) adenine deaminase
  KO
K01486  adenine deaminase [EC:3.5.4.2]
Organism
atf  Agrobacterium tumefaciens Ach5
Pathway
atf00230  Purine metabolism
atf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:atf00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Ach5_41250 (adeC)
Enzymes [BR:atf01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.2  adenine deaminase
     Ach5_41250 (adeC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adenine_deam_C Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-ProteinID: AKC09898
UniProt: A0A3G2DRC6
LinkDB All DBs
Position
linear:1587323..1589116
Genome map
AA seq 597 aa AA seqDB search
MSAQSPIREPVDLNDDALRARAVAAARGDAAFDVLITGGTLVDVVTGELRAADIGIVGPL
IASVHEPASRSDAAQLVDASGAFVSPGLIDTHMHIESSMITPAAYAAAVVARGVTTIVWD
PHEFGNVHGVEGVRWAAKSIENLPLRAILLAPSSVPSAPGLERGGADFDAGILADILSWP
QIGGVAEIMNMRGVIERDPRMSGIVQAGLVSEKLICGHARGLKDADLNAFMVAGVSSDHE
LVSAEDLMAKLRAGLTIELRGSHDHLLPEFVEALNALGHLPQTLTLCTDDVFPDDLLRGG
GLDDVVRRLVRYGLKPEWALRAATLNAAQRLGRADLGLIAAGRRADIVVFEDLSGFSARH
VLAGGRAVAEAGHMLVDIPACDAAALEGSMKLPLRAADDFRVACEGARVRLATIDRPRFT
QWGEAEAEVKDGFVVPPEGATMISVTHRHGKAEPVTRTGFLTGWGRWNGAFATTVSHDSH
NLTVFGGNAEDMALAANAVIATGGGMAVASEGKVTALLPLPLSGLVSDARLEDVAQAFEE
LRAAVGKVVDWQPPYLVFKACFGATLACNIGPHQTDMGIADVLTGRVMESPVIAVLE
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcacaatccccgatacgcgagccggtcgatctcaacgacgatgcgctgcgcgcc
cgcgcggttgccgctgcgcgcggcgatgcggctttcgatgttctcattactggcggaacg
ctggtggatgtggtgacgggggagcttcgcgccgctgatatcggcattgtcggtccgcta
atcgccagcgttcacgaaccggcaagccgcagcgatgcagcgcagctcgtcgacgcgtcg
ggcgcctttgtctcgcccggcctgatcgacacgcatatgcacatcgaaagttcgatgata
acgcccgctgcctatgcggcagccgtggttgcccgcggcgtcaccactatcgtctgggac
ccgcatgaattcggcaatgtccatggtgtcgaaggggtgcgctgggcggcgaaatccatc
gaaaacctgccgctgcgcgccattctgcttgcaccctcctcagtgccatcagcaccgggt
ctggagcgcggcggcgctgatttcgatgccggaattctcgctgatatcctgtcatggccg
cagattggcggggttgcggaaattatgaacatgcgcggcgtcatcgaacgcgatccgcgc
atgagcggcatcgtacaggccggtcttgtctcggaaaagctgatctgtggccatgcgcgc
ggcctgaaggacgccgatctcaacgccttcatggtggcaggcgtttcttccgatcacgag
ctggtctcggctgaagacctgatggcgaagcttcgggcggggttgaccatcgagctgcgc
ggctcgcacgatcatctgctgccggaatttgtggaggcgctgaatgcgctcggccacctg
ccgcagacgctgacgctctgcactgacgatgttttcccggatgacctgctgcggggcggc
gggctggatgatgtggtgcgccgccttgtccgttatggcctgaaaccggaatgggcgctg
cgcgccgcaacactgaatgctgcgcaaaggcttggccgtgccgatctcggcctcatcgcc
gccggtcgccgtgccgatatcgtcgttttcgaggatttgagtggtttttcagcccgtcat
gtcttggccggtggcagggcggttgcggaagccgggcatatgctcgtcgacattccagcc
tgcgatgcggcggcgctcgaaggctcgatgaagctgccgctgcgcgcagccgatgatttc
cgggttgcctgcgagggcgcaagggtgcgccttgccaccatcgaccgcccacgcttcacg
caatggggcgaggcggaagccgaggtgaaggatggtttcgtcgttccccccgaaggcgcc
acgatgatttccgtcacccaccgccacggcaaggccgagccagttaccaggaccggcttc
cttaccggctggggacgctggaacggcgccttcgccaccaccgtctcgcatgacagccac
aacctcactgtcttcggcggtaatgccgaagacatggcgctggccgccaatgcggtgatt
gcgacaggcggtggcatggctgtcgcctctgagggtaaggtgaccgcgcttctacccctg
ccgctctcaggcctcgtttccgatgcgcggcttgaagacgtagcacaggctttcgaggaa
ttgcgcgccgctgtcggcaaggtggtcgattggcagccaccctatctggtcttcaaagcc
tgcttcggcgccacgctcgcctgcaatatcggcccgcaccagacggatatgggcattgcc
gatgtgcttacgggacgggtgatggaaagcccggtgattgcggttctcgaatag

DBGET integrated database retrieval system