KEGG   Arabidopsis thaliana (thale cress): AT1G08130Help
Entry
AT1G08130         CDS       T00041                                 

Gene name
LIG1
Definition
(RefSeq) DNA ligase 1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03030  DNA replication
ath03410  Base excision repair
ath03420  Nucleotide excision repair
ath03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    AT1G08130 (LIG1)
   03410 Base excision repair
    AT1G08130 (LIG1)
   03420 Nucleotide excision repair
    AT1G08130 (LIG1)
   03430 Mismatch repair
    AT1G08130 (LIG1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ath03032]
    AT1G08130 (LIG1)
   03400 DNA repair and recombination proteins [BR:ath03400]
    AT1G08130 (LIG1)
Enzymes [BR:ath01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     AT1G08130 (LIG1)
    6.5.1.6  DNA ligase (ATP or NAD+)
     AT1G08130 (LIG1)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     AT1G08130 (LIG1)
DNA replication proteins [BR:ath03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    AT1G08130 (LIG1)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     AT1G08130 (LIG1)
DNA repair and recombination proteins [BR:ath03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     AT1G08130 (LIG1)
   NER (nucleotide excision repair)
    Other NER factors
     AT1G08130 (LIG1)
   MMR (mismatch excision repair)
    Other MMR factors
     AT1G08130 (LIG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-GeneID: 837333
NCBI-ProteinID: NP_172293
MIPS: AT1G08130.1
TAIR: AT1G08130
Araport: AT1G08130
UniProt: Q42572
LinkDB All DBs
Position
1
AA seq 790 aa AA seqDB search
MLAIRSSNYLRCIPSLCTKTQISQFSSVLISFSRQISHLRLSSCHRAMSSSRPSAFDALM
SNARAAAKKKTPQTTNLSRSPNKRKIGETQDANLGKTIVSEGTLPKTEDLLEPVSDSANP
RSDTSSIAEDSKTGAKKAKTLSKTDEMKSKIGLLKKKPNDFDPEKMSCWEKGERVPFLFV
ALAFDLISNESGRIVITDILCNMLRTVIATTPEDLVATVYLSANEIAPAHEGVELGIGES
TIIKAISEAFGRTEDHVKKQNTELGDLGLVAKGSRSTQTMMFKPEPLTVVKVFDTFRQIA
KESGKDSNEKKKNRMKALLVATTDCEPLYLTRLLQAKLRLGFSGQTVLAALGQAAVYNEE
HSKPPPNTKSPLEEAAKIVKQVFTVLPVYDIIVPALLSGGVWNLPKTCNFTLGVPIGPML
AKPTKGVAEILNKFQDIVFTCEYKYDGERAQIHFMEDGTFEIYSRNAERNTGKYPDVALA
LSRLKKPSVKSFILDCEVVAFDREKKKILPFQILSTRARKNVNVNDIKVGVCIFAFDMLY
LNGQQLIQENLKIRREKLYESFEEDPGYFQFATAVTSNDIDEIQKFLDASVDVGCEGLII
KTLDSDATYEPAKRSNNWLKLKKDYMDSIGDSVDLVPIAAFHGRGKRTGVYGAFLLACYD
VDKEEFQSICKIGTGFSDAMLDERSSSLRSQVIATPKQYYRVGDSLNPDVWFEPTEVWEV
KAADLTISPVHRAATGIVDPDKGISLRFPRLLRVREDKKPEEATSSEQIADLYQAQKHNH
PSNEVKGDDD
NT seq 2373 nt NT seq  +upstreamnt  +downstreamnt
atgttagcgattcgatcgtcgaattacctccgatgcataccttctctctgtactaaaacc
caaatctctcaattctcctccgtgttaatctcttttagccgccaaatttcccacttgcgt
cttagctcgtgccatagagccatgtcttcttcccgcccttctgcatttgatgctctcatg
tccaatgctcgtgcagccgccaagaagaagactccccagacaactaatttgtctcgctcg
ccgaacaaaaggaaaattggagaaacccaagatgctaatttgggcaaaactattgtttcc
gaaggtacacttccaaaaacggaggatctgctggagcctgtttctgattctgcaaatccc
agatcggatacatcgtcaattgcggaggattcaaagacgggagcgaaaaaggctaagact
ttgagcaagacagacgaaatgaagagcaaaattggattgctgaagaagaagccgaatgat
ttcgatcctgaaaaaatgtcttgctgggagaaaggggagagagttccgtttctgtttgtc
gcattggcttttgatctgatctcaaatgaaagtggccggattgtgattactgatattctg
tgtaacatgttgagaactgttattgccactactcctgaggatttggtcgctactgtttat
ctttcggcgaatgagattgccccggctcatgaaggtgtagaattgggaattggtgagagt
acaattatcaaggctatctctgaggcttttggtagaactgaggatcatgttaagaagcag
aatacggaactgggagacttgggacttgtagcaaaaggaagccgttcgactcagactatg
atgttcaagcccgaaccattgactgttgtcaaggttttcgatacgtttcgacaaattgct
aaggaaagtggaaaagatagtaatgaaaagaagaagaatcgaatgaaggcacttcttgtg
gcgacaacagactgtgaacctctttacttaacacgattacttcaggcaaaattgcggtta
gggttctcaggtcagactgtcttagccgcattgggacaagccgctgtatataatgaagag
cactcaaagccacccccaaataccaagtctcctttagaagaggctgcaaagattgttaaa
caagtattcactgtacttcctgtctatgacattattgttcctgctcttctaagtggcggt
gtgtggaatcttccaaaaacttgtaactttacattgggtgttccaattggacccatgctt
gcaaaaccaaccaaaggtgtagctgagatactgaataaattccaggacatcgttttcaca
tgtgaatacaaatatgatggggaacgtgcacagatacattttatggaggatggtacattt
gagatatacagtcgaaatgctgaaagaaacactgggaagtacccggatgttgctcttgcg
ttatcaagattaaagaagccttctgtgaaatcttttattctggattgtgaagttgttgct
ttcgacagggagaaaaagaaaattcttccgttccagattttgagcactcgagcccgtaaa
aatgtgaatgtcaatgatatcaaggttggcgtatgcatctttgcttttgacatgttatat
ctaaatggccaacaacttatccaggagaatcttaaaattcgccgagagaagctatacgaa
tcatttgaggaagatcctgggtatttccagtttgcaactgctgtaacatctaacgatatc
gatgaaatacaaaagtttcttgacgcttctgttgatgttggctgcgaaggtttaatcatt
aaaacattggactcagatgctacctatgagcctgcaaagcgatcaaataattggctaaaa
ctgaagaaagactatatggacagcattggggactctgtggatcttgtaccaattgctgct
ttccatggacgtggaaaacgcacaggtgtctatggtgcatttttactcgcttgctatgat
gttgataaggaagagttccagagcatttgtaaaattggtactggattttctgatgccatg
cttgacgagcggtcgtccagtcttcgctctcaagtgattgctactccaaaacaatactac
cgagttggagacagcctcaatccagatgtttggtttgagcccactgaggtctgggaagtg
aaagcagctgacttaacaattagccctgtgcaccgtgcagctactggcatagtggatcct
gataaggggatttctcttcgttttcctcgtctacttcgtgtacgggaagacaagaagccc
gaggaagcaacatcatctgagcagattgctgatttgtaccaagctcagaaacacaatcat
ccaagtaatgaagtcaaaggtgacgatgattga

DBGET integrated database retrieval system