KEGG   Arabidopsis thaliana (thale cress): AT1G11860Help
Entry
AT1G11860         CDS       T00041                                 

Definition
(RefSeq) Glycine cleavage T-protein family
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00260  Glycine, serine and threonine metabolism
ath00630  Glyoxylate and dicarboxylate metabolism
ath00670  One carbon pool by folate
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
ath01200  Carbon metabolism
Module
ath_M00532  Photorespiration
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    AT1G11860
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AT1G11860
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    AT1G11860
Enzymes [BR:ath01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     AT1G11860
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GCV_T GCV_T_C
Motif
Other DBs
NCBI-GeneID: 837733
NCBI-ProteinID: NP_172650
MIPS: AT1G11860.1
TAIR: AT1G11860
Araport: AT1G11860
UniProt: O65396 A0A178WFZ3
LinkDB All DBs
Position
1
AA seq 408 aa AA seqDB search
MRGGSLWQLGQSITRRLAQSDKKVVSRRYFASEADLKKTALYDFHVAHGGKMVPFAGWSM
PIQYKDSIMDSTVNCRENGSLFDVAHMCGLSLKGKDCVPFLETLVVADVAGLAPGTGSLT
VFTNEKGGAIDDSVITKVTDEHIYLVVNAGCRDKDLAHIEEHMKAFKSKGGDVSWHIHDE
RSLLALQGPLAAPVLQHLTKEDLSKLYFGNFQILDINGSTCFLTRTGYTGEDGFEISVPD
EHAVDLAKAILEKSEGKVRLTGLGARDSLRLEAGLCLYGNDMEQHISPVEAGLTWAIGKR
RRAEGGFLGADVILQQLKDGPTIRRVGFFSSGPPARSHSEVHDESGNKIGEITSGGFSPN
LKKNIAMGYVKSGQHKTGTKVKILVRGKPYEGSITKMPFVATKYYKPT
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgagaggtgggagtctatggcagctagggcaatcaataacccgtcgtcttgctcaatct
gacaagaaggttgtgtcacgtcgctactttgcctctgaagctgacctgaaaaagactgct
ctttacgacttccatgttgcccatggaggaaagatggttccttttgctggttggagtatg
ccaattcagtacaaagattcgattatggactcaacggttaactgcagggaaaatgggagt
ttgtttgatgttgcacatatgtgtggtttgagccttaagggtaaagattgtgttcctttt
cttgagacacttgtggttgctgatgtggctggtttggctcctggaactgggagcttaact
gtgttcacaaacgagaaaggaggtgccattgatgactcggtgattaccaaagtgacagat
gaacatatctatttggtggtcaatgctggctgtagggataaggatttggctcacattgaa
gaacacatgaaggctttcaaatccaaaggaggtgatgtctcgtggcatatccacgacgag
agatctcttcttgcccttcagggtcctttggctgctccagtgcttcaacacctgactaaa
gaagacttgagcaagctttactttggcaatttccagattctggacattaatggttccaca
tgtttccttaccaggactgggtataccggggaagatgggtttgagatttcggttccagat
gagcatgctgtggatctagcaaaagcaatcttggagaagtccgagggtaaggtaaggctt
acgggtctaggagcaagagacagtctcaggttagaagcaggactttgtctatatggaaac
gacatggagcaacacatttctcctgttgaagctgggctcacatgggccatagggaagcgt
agaagagccgaaggtggatttcttggcgcggatgtgattctccagcagcttaaagatgga
cctacaatcagaagggtcggtttcttctcctcaggaccacccgcaaggtcgcatagcgag
gttcatgatgagagtgggaacaagattggagagatcacaagtggagggtttagcccgaac
ctgaagaagaacatagccatgggatatgtgaagtcaggtcagcacaagactgggactaaa
gtcaagatcttggtccgtgggaaaccatatgaaggcagcatcacgaagatgccattcgtg
gccaccaaatactacaaaccaacatga

DBGET integrated database retrieval system