KEGG   Arabidopsis thaliana (thale cress): AT1G20500Help
Entry
AT1G20500         CDS       T00041                                 

Definition
(RefSeq) AMP-dependent synthetase and ligase family protein
  KO
K10526  OPC-8:0 CoA ligase 1 [EC:6.2.1.-]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00592  alpha-Linolenic acid metabolism
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
Module
ath_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09103 Lipid metabolism
   00592 alpha-Linolenic acid metabolism
    AT1G20500
Enzymes [BR:ath01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.-  
     AT1G20500
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-GeneID: 838638
NCBI-ProteinID: NP_173474
MIPS: AT1G20500.1
TAIR: AT1G20500
Araport: AT1G20500
UniProt: P0C5B6
LinkDB All DBs
Position
1
AA seq 550 aa AA seqDB search
MAYPERSLIVDPRSGFCKSNSTFYSKRQPLSLPPNLSRDVTTFISSQPHRGKTAFIDAAT
GQCLTFSDLWRAVDRVADCLYHEVGIRRGDVVLILSPNSIFIPVVCLSVMSLGAVFTTAN
TLNTSGEISKQIADSNPTLVFTTRQLAPKLPVAISVVLTDDEVYQELTSAIRVVGILSEM
VKKEPSGQRVRDRVNQDDTAMMLYSSGTTGPSKGVISSHRNLTAHVARFISDNLKRDDIF
ICTVPMFHTYGLLTFAMGTVALGSTVVILRRFQLHDMMDAVEKHRATALALAPPVLVAMI
NDADLIKAKYDLSSLKTVRCGGAPLSKEVTEGFLEKYPTVDILQGYALTESNGGGAFTNS
AEESRRYGTAGTLTSDVEARIVDPNTGRFMGINQTGELWLKGPSISKGYFKNQEATNETI
NLEGWLKTGDLCYIDEDGFLFVVDRLKELIKYKGYQVPPAELEALLITHPDILDAAVIPF
PDKEAGQYPMAYVVRKHESNLSEKQVIDFISKQVAPYKKIRKVSFINSIPKTASGKTLRK
DLIKLATSKL
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atggcgtatcctgagagatctctcattgttgatcctagaagtggtttctgcaaatcaaac
tctacattctatagcaagcgccaaccattaagtctcccgccaaatctttcgcgtgacgtc
accacattcatctcctctcagccacaccgtggcaaaaccgcctttatcgacgctgccaca
ggccagtgcttaaccttctccgatctctggagagccgtcgatcgcgtcgccgactgtcta
tatcatgaagtcggaatacgaagaggcgacgtcgtcctcatcctttctccaaactccatc
ttcattcccgttgtttgcctctccgtcatgtctctcggcgccgttttcaccaccgccaac
actctcaatacttccggtgaaatctccaaacagattgccgacagtaatccaactctcgtc
ttcactacgcgccagctggcaccaaaactccccgtcgctatctccgtcgttctcaccgac
gacgaagtttaccaggagctcactagcgcaatcagagtcgttgggattttaagcgagatg
gtgaagaaagaaccgagtgggcaacgagtcagggaccgagtcaaccaggacgacacggcg
atgatgctttactcgtcgggaaccacgggaccgagcaaaggagtgatctcgtctcaccgg
aatttaacagctcacgtggctagattcatatcggataatttgaaacgagacgatattttc
atctgtaccgtcccgatgttccacacctacggtttattgaccttcgctatgggcaccgta
gcattgggttcaacggtggtgatcctccggagatttcagctccacgatatgatggatgcg
gtggagaagcaccgagccacagctctggctttggcgccacctgttttggtagctatgatt
aacgacgcagatctgatcaaggctaagtacgatctgagctcactgaaaacggtgaggtgt
ggtggagcgccgttgagcaaggaggtgacggaagggtttctagagaaatatccgacggtt
gatatactgcaggggtatgctttgacggaatccaacggcggaggggctttcacgaattca
gcggaggagagccggagatatggcacggcggggacgttgacgtctgatgtggaggcgagg
atcgtggatccgaatacgggtcggttcatgggaattaaccaaacgggagagctctggctc
aagggcccttctatttctaaaggttattttaaaaaccaagaagctacaaatgaaaccatt
aatttagagggatggctaaaaactggagatctttgctacatcgatgaagatgggtttctt
tttgttgtggatcgattgaaagaactgataaaatacaaaggctatcaggtgcctccagct
gaactagaagctcttctgattactcatccggacattctcgatgccgccgttattcctttt
ccggacaaagaagcaggacaatatccaatggcttacgtggttcgaaaacacgagagcaat
ctctctgagaaacaagtcattgacttcatctctaagcaggtagcaccatataagaagata
agaaaggtctcatttataaactccataccaaaaactgcatccggtaagacgcttcgcaag
gatctaatcaaattggctacttctaaactttga

DBGET integrated database retrieval system