KEGG   Arabidopsis thaliana (thale cress): AT1G23800Help
Entry
AT1G23800         CDS       T00041                                 

Gene name
ALDH2B7
Definition
(RefSeq) aldehyde dehydrogenase 2B7
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00010  Glycolysis / Gluconeogenesis
ath00053  Ascorbate and aldarate metabolism
ath00071  Fatty acid degradation
ath00280  Valine, leucine and isoleucine degradation
ath00310  Lysine degradation
ath00330  Arginine and proline metabolism
ath00340  Histidine metabolism
ath00380  Tryptophan metabolism
ath00410  beta-Alanine metabolism
ath00561  Glycerolipid metabolism
ath00620  Pyruvate metabolism
ath00903  Limonene and pinene degradation
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AT1G23800 (ALDH2B7)
   00053 Ascorbate and aldarate metabolism
    AT1G23800 (ALDH2B7)
   00620 Pyruvate metabolism
    AT1G23800 (ALDH2B7)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AT1G23800 (ALDH2B7)
   00561 Glycerolipid metabolism
    AT1G23800 (ALDH2B7)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AT1G23800 (ALDH2B7)
   00310 Lysine degradation
    AT1G23800 (ALDH2B7)
   00330 Arginine and proline metabolism
    AT1G23800 (ALDH2B7)
   00340 Histidine metabolism
    AT1G23800 (ALDH2B7)
   00380 Tryptophan metabolism
    AT1G23800 (ALDH2B7)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AT1G23800 (ALDH2B7)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    AT1G23800 (ALDH2B7)
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     AT1G23800 (ALDH2B7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh DUF1487 DtxR
Motif
Other DBs
NCBI-GeneID: 838991
NCBI-ProteinID: NP_564204
MIPS: AT1G23800.1
TAIR: AT1G23800
Araport: AT1G23800
UniProt: Q8S528
LinkDB All DBs
Position
1
AA seq 534 aa AA seqDB search
MASRRVSSLLSRSFMSSSRSIFSLRGMNRGAQRYSNLAAAVENTITPPVKVEHTQLLIGG
RFVDAVSGKTFPTLDPRNGEVIAQVSEGDAEDVNRAVAAARKAFDEGPWPKMTAYERSKI
LFRFADLIEKHNDEIAALETWDNGKPYEQSAQIEVPMLARVFRYYAGWADKIHGMTMPGD
GPHHVQTLHEPIGVAGQIIPWNFPLLMLSWKLGPALACGNTVVLKTAEQTPLSALLVGKL
LHEAGLPDGVVNIVSGFGATAGAAIASHMDVDKVAFTGSTDVGKIILELASKSNLKAVTL
ELGGKSPFIVCEDADVDQAVELAHFALFFNQGQCCCAGSRTFVHERVYDEFVEKAKARAL
KRNVGDPFKSGIEQGPQVDSEQFNKILKYIKHGVEAGATLQAGGDRLGSKGYYIQPTVFS
DVKDDMLIATDEIFGPVQTILKFKDLDEVIARANNSRYGLAAGVFTQNLDTAHRLMRALR
VGTVWINCFDVLDASIPFGGYKMSGIGREKGIYSLNNYLQVKAVVTSLKNPAWL
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atggcatcaagaagagtttcttcgctgctctctcgctctttcatgtcctcctcacgttct
atcttctctcttagaggcatgaacagaggagctcaaagatacagtaacctcgctgctgct
gtcgaaaacactattactccaccagtgaaagttgaacacacacagcttctaatcggtgga
agattcgttgatgcagtgtcaggaaaaactttccctactttggatccaagaaatggagaa
gtgattgctcaagtgtctgaaggtgatgcagaagacgtgaaccgcgcggttgcagctgca
cgaaaggcttttgatgaaggaccatggcctaaaatgacagcttatgagagatcaaagata
ctgtttcgtttcgctgatttaatcgagaaacataatgatgagattgctgctcttgagact
tgggataatgggaaaccttatgaacaatctgctcaaattgaagtaccaatgcttgctagg
gtgttccggtactatgctggttgggcagacaagatacatggaatgacaatgccaggagat
ggtccacaccatgtgcagaccttacatgagcctataggagtcgctggacaaatcatccca
tggaacttccctcttctcatgctttcttggaaacttggaccagctttagcttgcggtaac
accgttgttctcaaaactgctgagcaaactcctctatctgctcttcttgttgggaaacta
cttcatgaggctggacttcctgatggagttgtgaatatagtttctggatttggggctact
gctggtgcagctatagctagtcacatggacgttgataaggttgctttcaccgggtctact
gatgttgggaagattattcttgagttagcttcaaaaagcaaccttaaggcagtgactctt
gagcttggaggaaagtcaccattcattgtatgtgaagatgctgatgtggatcaggccgtt
gagcttgcacatttcgctttgttctttaaccagggacaatgttgttgtgctggttcgcgt
acatttgtacatgaacgtgtgtatgatgagtttgtagagaaagctaaagctcgtgcactc
aagcgaaatgttggagatcccttcaagtcaggcattgagcaaggtccccaggtagactca
gagcaattcaacaaaatcctgaagtacatcaaacatggagttgaggctggagccacatta
caagctggaggtgacaggcttggttccaagggttactacattcaacctactgtcttctca
gatgtgaaagatgacatgctcatagcaacagacgagattttcgggccggttcaaaccata
ctgaaattcaaggatcttgatgaggtgattgcaagggccaacaactcaaggtacggttta
gctgctggagtgttcacacagaatcttgacacagcacaccggctgatgcgagcactcaga
gttgggactgtttggatcaactgttttgatgtacttgatgcatcaattccatttggaggg
tataagatgagtggcattggtagagagaaaggtatctacagtctcaacaattacttgcaa
gtcaaggctgttgttacttccctcaagaaccctgcctggctctaa

DBGET integrated database retrieval system