KEGG   Arabidopsis thaliana (thale cress): AT1G31160
Entry
AT1G31160         CDS       T00041                                 

Symbol
HINT_2
Name
(RefSeq) HISTIDINE TRIAD NUCLEOTIDE-BINDING 2
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB
Motif
Pfam: HIT DcpS_C
Other DBs
NCBI-GeneID: 840001
NCBI-ProteinID: NP_001322980
TAIR: AT1G31160
UniProt: A0A1P8AVM2
LinkDB
Position
1:complement(11122604..11124220)
AA seq 147 aa
MAVTSSSMLLLRNFSTVGRVAQSVRVTSRIFFSTGELIRVLPYTRSKRLICSTRAAHNEE
AAAKAAASVADTGAPTIFDKIIAKEIPSDIVYEDENVLAFRDINPQAPVHVLVIPKLRDG
LTSLGKIKILPETYLPLNRRRRLNQDT
NT seq 444 nt   +upstreamnt  +downstreamnt
atggctgtcacttcttcctctatgctgctgcttcggaacttctctacggtgggaagagtt
gctcaatctgttcgtgtgacttcgaggatcttcttctccaccggagaattgattagggtt
cttccttatactcgttctaaaagattgatctgttctactcgtgctgctcataatgaagaa
gccgccgcgaaagctgcggcttctgttgctgacaccggagctccgaccatatttgacaag
attatagcaaaagagattccctcagatattgtctatgaagatgaaaacgttttggcattc
agagacattaaccctcaggctcctgttcatgttttggtcattcccaagttgagagatggc
ttgacctcgcttggcaagattaagattttacctgaaacatatcttcctctgaaccgccgt
cgcaggctgaaccaagacacgtag

DBGET integrated database retrieval system