KEGG   Arabidopsis thaliana (thale cress): AT1G48175
Entry
AT1G48175         CDS       T00041                                 

Symbol
emb2191
Name
(RefSeq) Cytidine/deoxycytidylate deaminase family protein
  KO
K15441  tRNA-specific adenosine deaminase 2 [EC:3.5.4.-]
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
KEGG Orthology (KO) [BR:ath00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ath03016]
    AT1G48175 (emb2191)
Enzymes [BR:ath01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.-  
     AT1G48175 (emb2191)
Transfer RNA biogenesis [BR:ath03016]
 Eukaryotic type
  tRNA modification factors
   Deaminases
    AT1G48175 (emb2191)
SSDB
Motif
Pfam: dCMP_cyt_deam_1 MafB19-deam Bd3614-deam SNAD4 APOBEC4_like XOO_2897-deam APOBEC2 Inv-AAD
Other DBs
NCBI-GeneID: 841237
NCBI-ProteinID: NP_001321516
TAIR: AT1G48175
UniProt: Q6IDB6 A0A654EGI6
LinkDB
Position
1:17790364..17792340
AA seq 182 aa
MEEDHCEDSHNYMGFALHQAKLALEALEVPVGCVFLEDGKVIASGRNRTNETRNATRHAE
MEAIDQLVGQWQKDGLSPSQVAEKFSKCVLYVTCEPCIMCASALSFLGIKEVYYGCPNDK
FGGCGSILSLHLGSEEAQRGKGYKCRGGIMAEEAVSLFKCFYEQGNPNAPKPHRPVVQRE
RT
NT seq 549 nt   +upstreamnt  +downstreamnt
atggaagaggaccattgtgaggattctcataattatatgggttttgctctgcatcaggct
aaacttgctctggaggctcttgaagttcccgtgggatgtgtttttcttgaggacggtaag
gtcattgcttcagggcgaaaccgaacaaatgagacacgcaatgccacaagacatgcagag
atggaagcaattgatcagcttgtcggacagtggcagaaagatggactctcaccttcacaa
gtcgctgagaaattctcgaaatgtgttctttatgtaacatgtgaaccttgcataatgtgt
gcatcggccttatcgtttctcggtatcaaggaagtgtattatggatgtccaaatgataaa
tttgggggatgtggttccattttgtcgcttcacttaggtagtgaggaagctcaaagagga
aaaggatacaagtgcagaggaggaataatggcagaagaagctgtctctcttttcaaatgt
ttctatgagcaaggcaatcccaacgctccaaagccacaccgccctgttgttcaaagagag
aggacttga

DBGET integrated database retrieval system