KEGG   Arabidopsis thaliana (thale cress): AT1G49430
Entry
AT1G49430         CDS       T00041                                 
Symbol
LACS2
Name
(RefSeq) long-chain acyl-CoA synthetase 2
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00061  Fatty acid biosynthesis
ath00071  Fatty acid degradation
ath01100  Metabolic pathways
ath01212  Fatty acid metabolism
ath04146  Peroxisome
Module
ath_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    AT1G49430 (LACS2)
   00071 Fatty acid degradation
    AT1G49430 (LACS2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    AT1G49430 (LACS2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ath01004]
    AT1G49430 (LACS2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ath04147]
    AT1G49430 (LACS2)
Enzymes [BR:ath01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     AT1G49430 (LACS2)
Lipid biosynthesis proteins [BR:ath01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   AT1G49430 (LACS2)
Exosome [BR:ath04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   AT1G49430 (LACS2)
  Exosomal proteins of breast cancer cells
   AT1G49430 (LACS2)
SSDB
Motif
Pfam: AMP-binding AMP-binding_C
Other DBs
NCBI-GeneID: 841367
NCBI-ProteinID: NP_175368
TAIR: AT1G49430
UniProt: Q9XIA9 A0A178W3L9
LinkDB
Position
1:18290942..18295905
AA seq 665 aa
MSLAADNVLLVEEGRPATAEHPSAGPVYRCKYAKDGLLDLPTDIDSPWQFFSEAVKKYPN
EQMLGQRVTTDSKVGPYTWITYKEAHDAAIRIGSAIRSRGVDPGHCCGIYGANCPEWIIA
MEACMSQGITYVPLYDSLGVNAVEFIINHAEVSLVFVQEKTVSSILSCQKGCSSNLKTIV
SFGEVSSTQKEEAKNQCVSLFSWNEFSLMGNLDEANLPRKRKTDICTIMYTSGTTGEPKG
VILNNAAISVQVLSIDKMLEVTDRSCDTSDVFFSYLPLAHCYDQVMEIYFLSRGSSVGYW
RGDIRYLMDDVQALKPTVFCGVPRVYDKLYAGIMQKISASGLIRKKLFDFAYNYKLGNMR
KGFSQEEASPRLDRLMFDKIKEALGGRAHMLLSGAAPLPRHVEEFLRIIPASNLSQGYGL
TESCGGSFTTLAGVFSMVGTVGVPMPTVEARLVSVPEMGYDAFSADVPRGEICLRGNSMF
SGYHKRQDLTDQVLIDGWFHTGDIGEWQEDGSMKIIDRKKNIFKLSQGEYVAVENLENTY
SRCPLIAQIWVYGNSFESFLVGVVVPDRKAIEDWAKLNYQSPNDFESLCQNLKAQKYFLD
ELNSTAKQYQLKGFEMLKAIHLEPNPFDIERDLITPTFKLKRPQLLQHYKGIVDQLYSEA
KRSMA
NT seq 1998 nt   +upstreamnt  +downstreamnt
atgtctttagccgcggataatgtgttgttggtggaagaaggaaggccagccacagcggaa
catccatcggccggaccggtttatcgatgtaaatacgctaaagatggcctcctcgatctc
cctaccgatattgattctccttggcagttctttagtgaggctgtgaagaaatatccgaat
gagcaaatgttgggccaacgcgtaacgactgattctaaggtcggtccatacacgtggatc
acatataaggaagcgcacgacgctgcaattcggattggatcagcaatcagaagccgaggc
gttgatccgggacactgttgtggtatttacggagctaattgtccagaatggattattgca
atggaggcctgcatgagccaagggatcacctacgtgcctctatacgattctttaggcgta
aacgcagttgaattcatcatcaaccacgccgaggtttcgctagtatttgttcaagagaag
acagtttcatcgatcttatcgtgccaaaagggatgttcttcgaatttgaagactattgtg
agcttcggggaagtctcgagtacacaaaaggaagaagctaagaaccaatgtgtttcttta
ttttcatggaatgagttctcactaatgggaaacttagatgaggcaaatctacctcgtaag
cgaaagacagacatctgcacaataatgtacacaagcgggacgactggagaacccaaaggt
gtaatcttaaacaacgcagcaatttcggtccaggttttatccatagacaaaatgcttgaa
gtcactgatcgatcgtgtgacacgagcgatgtgttcttctcgtacttgccattagcacat
tgctatgatcaagtcatggagatttactttttatctagaggctcctctgttggatactgg
cgtggcgacattcggtacctgatggatgatgttcaagctcttaaacctactgtgttttgc
ggtgttccacgagtttacgacaaactatatgccggtataatgcaaaaaatatcagctagt
ggcttgatacgcaagaaactgtttgattttgcttataactacaaattgggaaatatgaga
aaaggattctctcaagaagaagcttctcctcgtctagacagacttatgttcgataagata
aaagaagcattaggaggaagagctcatatgttgttatcaggagcagcgcctctacctcgt
catgtagaggagttcttgagaatcattcctgcctctaatctctctcaaggttatggattg
actgagagttgtgggggaagcttcacgaccttagccggagtattttctatggtggggaca
gtgggtgtgccaatgcccacggtggaggcaaggctagtgtccgtaccagagatgggttac
gacgccttttccgctgacgtgccgagaggagagatttgtcttagaggaaattcaatgttt
tctggttaccataaaagacaagatctaactgatcaagtcctaatcgatggatggttccac
acaggagatattggagaatggcaagaagatggatcaatgaagatcatcgataggaagaag
aacatcttcaagttgtctcaaggtgaatatgttgctgttgaaaacctcgaaaacacttac
tcaagatgtcccctcattgctcagatatgggtctatggcaacagcttcgagtcatttttg
gtaggtgtggttgtacctgatagaaaagctattgaagattgggctaaactcaattaccaa
tctcccaatgatttcgaatctctatgtcaaaatctcaaagctcaaaaatacttcttggat
gagcttaactctaccgcaaagcaatatcaacttaaaggatttgaaatgttaaaagctatt
catttagaaccaaacccttttgatattgaaagagatcttattactccaactttcaagctg
aaaaggccacagctcctccaacattacaagggcatagttgatcaactttattcagaagca
aagaggtccatggcatag

KEGG   Arabidopsis thaliana (thale cress): AT1G64400
Entry
AT1G64400         CDS       T00041                                 
Symbol
LACS3
Name
(RefSeq) AMP-dependent synthetase and ligase family protein
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00061  Fatty acid biosynthesis
ath00071  Fatty acid degradation
ath01100  Metabolic pathways
ath01212  Fatty acid metabolism
ath04146  Peroxisome
Module
ath_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    AT1G64400 (LACS3)
   00071 Fatty acid degradation
    AT1G64400 (LACS3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    AT1G64400 (LACS3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ath01004]
    AT1G64400 (LACS3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ath04147]
    AT1G64400 (LACS3)
Enzymes [BR:ath01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     AT1G64400 (LACS3)
Lipid biosynthesis proteins [BR:ath01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   AT1G64400 (LACS3)
Exosome [BR:ath04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   AT1G64400 (LACS3)
  Exosomal proteins of breast cancer cells
   AT1G64400 (LACS3)
SSDB
Motif
Pfam: AMP-binding AMP-binding_C
Other DBs
NCBI-GeneID: 842748
NCBI-ProteinID: NP_176622
TAIR: AT1G64400
UniProt: Q9C7W4
LinkDB
Position
1:complement(23915570..23919835)
AA seq 665 aa
MATGRYIVEVEKGKQGVDGGSPSVGPVYRSIYAKDGFPEPPDDLVSAWDIFRLSVEKSPN
NPMLGRREIVDGKAGKYVWQTYKEVHNVVIKLGNSIRTIGVGKGDKCGIYGANSPEWIIS
MEACNAHGLYCVPLYDTLGAGAIEFIICHAEVSLAFAEENKISELLKTAPKSTKYLKYIV
SFGEVTNNQRVEAERHRLTIYSWDQFLKLGEGKHYELPEKRRSDVCTIMYTSGTTGDPKG
VLLTNESIIHLLEGVKKLLKTIDEELTSKDVYLSYLPLAHIFDRVIEELCIYEAASIGFW
RGDVKILIEDIAALKPTVFCAVPRVLERIYTGLQQKLSDGGFVKKKLFNFAFKYKHKNME
KGQPHEQASPIADKIVFKKVKEGLGGNVRLILSGAAPLAAHIESFLRVVACAHVLQGYGL
TESCGGTFVSIPNELSMLGTVGPPVPNVDIRLESVPEMGYDALASNPRGEICIRGKTLFS
GYYKREDLTQEVFIDGWLHTGDVGEWQPDGAMKIIDRKKNIFKLSQGEYVAVENLENIYS
HVAAIESIWVYGNSYESYLVAVVCPSKIQIEHWAKEHKVSGDFESICRNQKTKEFVLGEF
NRVAKDKKLKGFELIKGVHLDTVPFDMERDLITPSYKMKRPQLLKYYQKEIDEMYKKNRE
VQLRV
NT seq 1998 nt   +upstreamnt  +downstreamnt
atggcgactggtcgatacatcgttgaggttgagaagggaaagcaaggcgttgatggagga
agtccatcggtcggtccagtgtaccggagtatctatgctaaagacggttttcctgaaccg
cctgatgatctcgtcagtgcatgggatattttccgtttatctgtggagaaatctccaaat
aatcctatgcttggtcgtagagaaatagttgatggaaaagctgggaaatatgtatggcaa
acttacaaagaagtacataatgtagtgattaagcttggaaactctatcagaactattgga
gttggaaaaggagataaatgcggtatttatggcgccaatagtcctgaatggattataagc
atggaggcttgcaatgctcatggactctactgtgtacctttatatgacactctaggtgct
ggagcaatagaattcatcatttgtcatgctgaggtctcacttgcttttgctgaggagaac
aagatttctgagttattgaagacagctccaaaatcaactaaatatttgaagtatattgtg
agctttggtgaggttacaaataatcagagagtagaagctgagaggcacagattaacaata
tattcatgggaccaattcttgaagctaggcgagggtaaacattatgaattaccagagaag
aggagaagcgatgtttgcaccataatgtatacaagtggcacaactggtgatcctaaagga
gtattgcttacaaatgagagcattattcatctccttgaaggtgttaaaaaattgcttaaa
actattgatgaagagttaaccagtaaagatgtatatctctcatatctacctctggctcat
atcttcgatcgtgtgattgaggagctgtgtatttatgaagcagcctctatcggattctgg
cgaggggatgttaagatattgatagaagacattgctgcattgaaaccgactgttttctgc
gctgttcctcgcgttctagagagaatatacaccggtcttcagcagaaactttctgatggt
ggttttgtaaagaagaaattattcaactttgcattcaaatacaaacataaaaacatggag
aaagggcagcctcatgaacaagcatctccaatagctgacaaaattgtatttaaaaaggta
aaagaagggttgggaggaaacgtgcgtcttatcctctcaggagcagctcctcttgcagct
cacatcgaatctttccttcgagttgtcgcgtgtgctcatgttttgcaaggatacggtcta
acagagagttgtggtgggacttttgtgtccattccaaacgagctttcaatgcttggaacg
gttggtccaccggttccaaacgttgacataaggctagagtcagttccagagatgggttat
gacgctcttgcaagcaatccacgtggagagatttgcatcaggggaaagactttgttctct
ggatactacaaacgtgaagatctcactcaagaagtcttcattgatggatggcttcacact
ggtgatgtcggtgagtggcaaccagatggagccatgaagatcatcgaccgtaagaagaac
atctttaaactgtctcaaggagaatacgttgccgttgagaacttggagaacatatacagt
catgtcgccgccattgaatcgatatgggtatatggaaacagctatgagtcttacttagtg
gctgtggtatgtccaagcaagatccagatcgagcattgggccaaagaacacaaagtttca
ggagactttgagtctatctgccgaaaccaaaagactaaagagtttgtccttggagagttc
aacagagtagccaaagacaaaaagctgaagggatttgagctgatcaaaggtgttcatttg
gacacagtcccgttcgacatggaaagagatctcatcactccttcttacaagatgaaaaga
cctcagcttctcaagtactatcagaaagagattgatgaaatgtataagaaaaacagagaa
gtgcagctacgagtgtaa

KEGG   Arabidopsis thaliana (thale cress): AT1G77590
Entry
AT1G77590         CDS       T00041                                 
Symbol
LACS9
Name
(RefSeq) long chain acyl-CoA synthetase 9
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00061  Fatty acid biosynthesis
ath00071  Fatty acid degradation
ath01100  Metabolic pathways
ath01212  Fatty acid metabolism
ath04146  Peroxisome
Module
ath_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    AT1G77590 (LACS9)
   00071 Fatty acid degradation
    AT1G77590 (LACS9)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    AT1G77590 (LACS9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ath01004]
    AT1G77590 (LACS9)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ath04147]
    AT1G77590 (LACS9)
Enzymes [BR:ath01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     AT1G77590 (LACS9)
Lipid biosynthesis proteins [BR:ath01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   AT1G77590 (LACS9)
Exosome [BR:ath04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   AT1G77590 (LACS9)
  Exosomal proteins of breast cancer cells
   AT1G77590 (LACS9)
SSDB
Motif
Pfam: AMP-binding AMP-binding_C
Other DBs
NCBI-GeneID: 844094
NCBI-ProteinID: NP_177882
TAIR: AT1G77590
UniProt: Q9CAP8 A0A7G2E866
LinkDB
Position
1:complement(29148160..29152395)
AA seq 691 aa
MIPYAAGVIVPLALTFLVQKSKKEKKRGVVVDVGGEPGYAIRNHRFTEPVSSHWEHISTL
PELFEISCNAHSDRVFLGTRKLISREIETSEDGKTFEKLHLGDYEWLTFGKTLEAVCDFA
SGLVQIGHKTEERVAIFADTREEWFISLQGCFRRNVTVVTIYSSLGEEALCHSLNETEVT
TVICGSKELKKLMDISQQLETVKRVICMDDEFPSDVNSNWMATSFTDVQKLGRENPVDPN
FPLSADVAVIMYTSGSTGLPKGVMMTHGNVLATVSAVMTIVPDLGKRDIYMAYLPLAHIL
ELAAESVMATIGSAIGYGSPLTLTDTSNKIKKGTKGDVTALKPTIMTAVPAILDRVRDGV
RKKVDAKGGLSKKLFDFAYARRLSAINGSWFGAWGLEKLLWDVLVFRKIRAVLGGQIRYL
LSGGAPLSGDTQRFINICVGAPIGQGYGLTETCAGGTFSEFEDTSVGRVGAPLPCSFVKL
VDWAEGGYLTSDKPMPRGEIVIGGSNITLGYFKNEEKTKEVYKVDEKGMRWFYTGDIGRF
HPDGCLEIIDRKKDIVKLQHGEYVSLGKVEAALSISPYVENIMVHADSFYSYCVALVVAS
QHTVEGWASKQGIDFANFEELCTKEQAVKEVYASLVKAAKQSRLEKFEIPAKIKLLASPW
TPESGLVTAALKLKRDVIRREFSEDLTKLYA
NT seq 2076 nt   +upstreamnt  +downstreamnt
atgattccttatgctgctggtgttattgtgccattggctttgacgtttctggttcagaaa
tctaagaaagaaaagaaaagaggtgttgttgttgatgttggtggtgaaccaggttatgct
attaggaatcacaggtttactgagcctgttagttcccattgggaacatatctcaacgctt
ccagagctctttgagatatcgtgtaatgctcacagtgatagggttttccttggcacccga
aagctgatctctagagagattgagactagtgaggatggaaaaacgttcgagaaactgcat
ttaggtgactacgagtggctcacttttgggaagactctcgaagcagtgtgtgattttgcc
tctgggttagttcagattgggcacaagacggaagagcgtgtcgccatttttgcagatact
agagaagaatggttcatctccctacagggttgcttcaggcgcaacgtcactgtggtaact
atctattcatctttgggagaggaagctctttgtcactcgctgaatgagacagaggtcaca
accgtaatatgtggtagcaaagaactcaaaaagctcatggacataagccaacagcttgaa
actgtgaaacgtgtgatatgcatggatgatgaattcccatctgatgtgaacagtaattgg
atggcgacttcatttactgatgttcagaaacttggccgcgaaaatcctgtggatcctaat
ttccctctctcagcagatgttgctgttataatgtacaccagtggaagcactggacttccc
aagggtgttatgatgacgcatggtaatgtcctagctacagtttcggcagtgatgacaatt
gttcctgaccttggaaagagggatatatacatggcatatttacctttggctcacatcctt
gagttagcagctgagagcgtaatggctactattgggagtgctattggatatgggtctccc
ttgacgctaacggatacttcaaacaagataaaaaagggtacaaaaggagatgtcacagca
ctaaagcccactataatgacagctgttccagccattcttgatcgtgtcagggatggtgtc
cgcaaaaaggttgatgcaaagggcggattgtcaaagaaattgtttgactttgcatatgct
cggcgattatctgcaatcaatggaagttggtttggagcctggggattggaaaagcttttg
tgggatgtgcttgtgttcaggaaaatccgtgcagttttgggaggtcaaatccgctatttg
ctctctggtggtgcccctctttctggtgacactcagagattcattaacatctgcgttggg
gctccaatcggtcagggatatgggctcacagagacttgtgctggtggaaccttctcggag
tttgaggacacatccgttggccgtgttggtgctccacttccttgctcctttgtaaagcta
gtagactgggcggaaggtgggtatctaactagtgataagccgatgccccgtggtgaaatt
gtaattggtggctcaaatatcacgcttgggtatttcaaaaatgaggagaaaactaaagaa
gtgtacaaggttgatgaaaagggaatgaggtggttctacacaggagacataggacgattt
caccctgatggctgcctcgagataatagaccgaaaaaaggatatcgttaaacttcagcat
ggagaatatgtctccttgggcaaagttgaagctgctctaagtataagtccctatgttgaa
aacataatggttcatgctgattcgttctacagttactgtgtggctcttgtggtcgcgtcc
caacatacagttgaaggttgggcttcaaagcaaggaatagactttgccaacttcgaagaa
ctgtgcacgaaagagcaagccgtgaaagaagtgtatgcgtcccttgtgaaggcggctaaa
caatcacgattggagaagtttgagataccagcaaagatcaaattattggcatctccatgg
acgccagagtcaggattagtcacagcagctctaaagctgaaaagagatgtaattaggagg
gaattctctgaagatctcaccaagttatatgcctaa

KEGG   Arabidopsis thaliana (thale cress): AT2G04350
Entry
AT2G04350         CDS       T00041                                 
Symbol
LACS8
Name
(RefSeq) AMP-dependent synthetase and ligase family protein
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00061  Fatty acid biosynthesis
ath00071  Fatty acid degradation
ath01100  Metabolic pathways
ath01212  Fatty acid metabolism
ath04146  Peroxisome
Module
ath_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    AT2G04350 (LACS8)
   00071 Fatty acid degradation
    AT2G04350 (LACS8)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    AT2G04350 (LACS8)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ath01004]
    AT2G04350 (LACS8)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ath04147]
    AT2G04350 (LACS8)
Enzymes [BR:ath01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     AT2G04350 (LACS8)
Lipid biosynthesis proteins [BR:ath01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   AT2G04350 (LACS8)
Exosome [BR:ath04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   AT2G04350 (LACS8)
  Exosomal proteins of breast cancer cells
   AT2G04350 (LACS8)
SSDB
Motif
Pfam: AMP-binding AMP-binding_C
Other DBs
NCBI-GeneID: 814974
NCBI-ProteinID: NP_178516
TAIR: AT2G04350
UniProt: Q9SJD4 A0A654ETF2
LinkDB
Position
2:1515634..1519308
AA seq 720 aa
MEDSGVNPMDSPSKGSDFGVYGIIGGGIVALLVPVLLSVVLNGTKKGKKRGVPIKVGGEE
GYTMRHARAPELVDVPWEGAATMPALFEQSCKKYSKDRLLGTREFIDKEFITASDGRKFE
KLHLGEYKWQSYGEVFERVCNFASGLVNVGHNVDDRVAIFSDTRAEWFIAFQGCFRQSIT
VVTIYASLGEEALIYSLNETRVSTLICDSKQLKKLSAIQSSLKTVKNIIYIEEDGVDVAS
SDVNSMGDITVSSISEVEKLGQKNAVQPILPSKNGVAVIMFTSGSTGLPKGVMITHGNLV
ATAAGVMKVVPKLDKNDTYIAYLPLAHVFELEAEIVVFTSGSAIGYGSAMTLTDTSNKVK
KGTKGDVSALKPTIMTAVPAILDRVREGVLKKVEEKGGMAKTLFDFAYKRRLAAVDGSWF
GAWGLEKMLWDALVFKKIRAVLGGHIRFMLVGGAPLSPDSQRFINICMGSPIGQGYGLTE
TCAGATFSEWDDPAVGRVGPPLPCGYVKLVSWEEGGYRISDKPMPRGEIVVGGNSVTAGY
FNNQEKTDEVYKVDEKGTRWFYTGDIGRFHPDGCLEVIDRKKDIVKLQHGEYVSLGKVEA
ALGSSNYVDNIMVHADPINSYCVALVVPSRGALEKWAEEAGVKHSEFAELCEKGEAVKEV
QQSLTKAGKAAKLEKFELPAKIKLLSEPWTPESGLVTAALKIKREQIKSKFKDELSKLYA
NT seq 2163 nt   +upstreamnt  +downstreamnt
atggaagattctggagtgaatccaatggattcaccatctaaaggcagtgactttggagtc
tatggaatcataggaggtggaatcgtggctttacttgtgcctgtgttactctctgtggtg
ttgaatggaaccaaaaaggggaaaaagagaggtgttcccatcaaagtaggtggcgaggaa
ggttacacaatgcgtcatgctcgagctcctgaattggttgatgtaccttgggaaggagct
gctactatgcctgctttgtttgagcagtcttgtaagaagtattcgaaagatcggttacta
ggaactagagagtttatagataaggaatttattactgctagtgatgggaggaagtttgag
aagcttcatttaggagagtataaatggcaaagttatggagaggtttttgaacgtgtttgt
aactttgcgtcggggttagttaatgtaggacataatgttgatgatcgtgttgctatcttt
tcggatactcgtgctgagtggtttatcgcgtttcagggatgtttcaggcagagcataacc
gttgttactatttatgcttctttaggagaagaggctttgatttactcactcaatgagact
cgagtgtcaaccttaatatgtgactcaaaacaacttaagaagttgtctgcgatacaatca
agcttgaaaactgtgaagaacattatttacattgaagaagatggagtagatgttgcttct
agtgatgtcaatagtatgggtgatataactgtttcgtcgatctctgaagttgagaaactt
gggcagaagaacgctgttcaaccgatcttaccttcgaagaatggagttgctgttataatg
tttaccagtggtagtactggtctaccaaagggagttatgattacccacggaaatcttgtc
gcaactgctgcaggagttatgaaggtggttccaaagttggataaaaatgatacatatatt
gcgtacttacctttggctcatgtgtttgagctggaagctgagattgtggtctttacctca
ggtagtgccatcggttacggctcagcaatgactttaactgacacttcaaataaagttaag
aaaggaaccaaaggagatgtttcagctctgaagccaactataatgactgcagttccagct
attctggatcgtgtccgagaaggagttcttaaaaaggttgaggaaaagggagggatggcg
aagaccctttttgactttgcatacaagcgccggttagcagctgtggatggaagttggttt
ggtgcctggggtttggagaaaatgttatgggatgctcttgtcttcaagaaaatacgcgct
gtgcttggaggacacatccgttttatgctcgttggaggagctcctctgtctcctgattcg
caacgcttcatcaatatctgcatggggtctcccatcggccaaggatatggattgactgaa
acgtgtgctggagctacgttttctgagtgggacgatcctgctgttggtcgtgttggacct
ccacttccatgcggctacgttaagctcgtttcttgggaagaaggtggctacagaatttca
gataaaccaatgcctagaggggagattgtggtaggtggtaacagtgtaacagcaggttac
ttcaacaatcaagaaaaaaccgatgaggtttacaaggtcgatgagaagggcacaaggtgg
ttttacaccggagatattgggagattccaccctgatggatgtctcgaagtcatcgataga
aagaaagatattgttaaacttcaacatggggaatacgtatcccttggaaaggtggaggca
gctttgggttcgagcaattacgttgataacatcatggtccacgcagacccaattaacagc
tactgtgtagctcttgttgttccatcacgaggagcattagagaaatgggcagaggaagct
ggagttaaacacagcgaattcgctgagctatgcgagaaaggtgaagcagtcaaggaggtt
caacaatctcttaccaaggccgggaaggcggcaaagctcgaaaagtttgagcttccagca
aagatcaagttgctgtcagagccgtggacaccggagtcgggattggtcactgctgctctt
aagataaagagagaacaaataaagtccaagttcaaagatgaactcagcaagttatatgcc
taa

KEGG   Arabidopsis thaliana (thale cress): AT2G47240
Entry
AT2G47240         CDS       T00041                                 
Symbol
LACS1
Name
(RefSeq) AMP-dependent synthetase and ligase family protein
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00061  Fatty acid biosynthesis
ath00071  Fatty acid degradation
ath01100  Metabolic pathways
ath01212  Fatty acid metabolism
ath04146  Peroxisome
Module
ath_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    AT2G47240 (LACS1)
   00071 Fatty acid degradation
    AT2G47240 (LACS1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    AT2G47240 (LACS1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ath01004]
    AT2G47240 (LACS1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ath04147]
    AT2G47240 (LACS1)
Enzymes [BR:ath01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     AT2G47240 (LACS1)
Lipid biosynthesis proteins [BR:ath01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   AT2G47240 (LACS1)
Exosome [BR:ath04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   AT2G47240 (LACS1)
  Exosomal proteins of breast cancer cells
   AT2G47240 (LACS1)
SSDB
Motif
Pfam: AMP-binding AMP-binding_C Haem_oxygenas_2
Other DBs
NCBI-GeneID: 819337
NCBI-ProteinID: NP_001318440
TAIR: AT2G47240
UniProt: O22898
LinkDB
Position
2:19392497..19397907
AA seq 660 aa
MKSFAAKVEEGVKGIDGKPSVGPVYRNLLSEKGFPPIDSEITTAWDIFSKSVEKFPDNNM
LGWRRIVDEKVGPYMWKTYKEVYEEVLQIGSALRAAGAEPGSRVGIYGVNCPQWIIAMEA
CAAHTLICVPLYDTLGSGAVDYIVEHAEIDFVFVQDTKIKGLLEPDCKCAKRLKAIVSFT
NVSDELSHKASEIGVKTYSWIDFLHMGREKPEDTNPPKAFNICTIMYTSGTSGDPKGVVL
THQAVATFVVGMDLYMDQFEDKMTHDDVYLSFLPLAHILDRMNEEYFFRKGASVGYYHGN
LNVLRDDIQELKPTYLAGVPRVFERIHEGIQKALQELNPRRRFIFNALYKHKLAWLNRGY
SHSKASPMADFIAFRKIRDKLGGRIRLLVSGGAPLSPEIEEFLRVTCCCFVVQGYGLTET
LGGTALGFPDEMCMLGTVGIPAVYNEIRLEEVSEMGYDPLGENPAGEICIRGQCMFSGYY
KNPELTEEVMKDGWFHTGDIGEILPNGVLKIIDRKKNLIKLSQGEYVALEHLENIFGQNS
VVQDIWVYGDSFKSMLVAVVVPNPETVNRWAKDLGFTKPFEELCSFPELKEHIISELKST
AEKNKLRKFEYIKAVTVETKPFDVERDLVTATLKNRRNNLLKYYQVQIDEMYRKLASKKI
NT seq 1983 nt   +upstreamnt  +downstreamnt
atgaagtcttttgcggctaaggtagaagagggagttaaaggaatagacggaaagccgtcg
gtaggtccggtgtaccggaatcttctgtcggaaaaaggttttcctccgattgattctgag
atcaccactgcttgggacattttcagtaaatcagtggagaaattccctgacaataatatg
cttggatggcgtcgaattgttgatgagaaggttggaccatatatgtggaaaacgtacaag
gaagtatacgaagaagttttgcagattggctctgcactacgagccgccggagctgaacct
gggagtcgagtggggatctacggtgttaattgtcctcagtggatcatagcaatggaggct
tgtgcagctcacactctaatctgtgtacctctatatgatacattgggttcaggagcagtc
gattacattgtagagcatgcggaaatcgactttgtgtttgtccaagacaccaaaattaaa
ggacttcttgagccagattgcaaatgtgctaaacggctaaaagctatagtttccttcact
aacgtgagcgacgagcttagccacaaggcttcagaaattggagtcaaaacatactcctgg
atcgattttctccatatgggacgtgagaaaccggaagacacgaacccgcctaaggcgttt
aacatatgcaccataatgtacaccagcggcacaagcggtgatcctaaaggtgtggttttg
actcaccaagcggtcgcgacttttgttgttgggatggatctctatatggaccagtttgaa
gataagatgacacatgatgatgtgtatctctccttcttgcccttggctcatattcttgac
cgtatgaacgaggaatacttctttcgcaaaggcgcttccgtcggctattaccatggaaat
ttgaacgtgttacgtgacgatattcaagaactgaaaccgacttatctagctggagtacca
agagtgtttgagagaatccatgaggggattcaaaaggctcttcaagaacttaacccaaga
aggagattcatcttcaatgctctctacaaacacaagcttgcgtggttgaatcgtgggtac
tctcatagtaaagcttcacccatggctgatttcattgctttcagaaagattagagacaaa
ttgggaggtcgcatccggttgctagtatctggaggagcacctttgagccctgagattgaa
gagtttttgagagttacttgttgttgctttgtcgttcaaggctacggtctaacggagaca
cttggaggaacggctttgggtttcccggacgagatgtgtatgctagggacagtcggtatt
ccagcggtttacaacgagatacggcttgaagaggtgtctgaaatgggctatgacccgctc
ggagaaaatccggcaggagagatctgtataagaggacaatgtatgttttcagggtattac
aagaaccctgaactcactgaagaagtcatgaaagatggatggttccacacaggagatata
ggtgagattcttccaaacggagtactcaagatcatcgatcgtaaaaagaatctgatcaaa
ctttctcaaggagaatatgttgctctcgagcatttggaaaacatcttcgggcaaaactct
gttgtccaagatatatgggtttatggagacagcttcaaatctatgcttgtcgcggtggtt
gttcccaacccagaaaccgtcaacaggtgggctaaagatctcggttttactaaaccattc
gaagaactctgttctttcccggaactaaaagaacacatcatttcagaactgaagtccacg
gcagaaaagaacaagctaagaaagtttgagtacatcaaagcggtgacagtggagacaaaa
cctttcgacgtagagagagacttagtgactgcgacgctcaagaatcggaggaacaatctt
ctcaaatattatcaggtgcaaatcgacgaaatgtaccgcaaattggcctcaaagaaaatc
tga

KEGG   Arabidopsis thaliana (thale cress): AT3G05970
Entry
AT3G05970         CDS       T00041                                 
Symbol
LACS6
Name
(RefSeq) long-chain acyl-CoA synthetase 6
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00061  Fatty acid biosynthesis
ath00071  Fatty acid degradation
ath01100  Metabolic pathways
ath01212  Fatty acid metabolism
ath04146  Peroxisome
Module
ath_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    AT3G05970 (LACS6)
   00071 Fatty acid degradation
    AT3G05970 (LACS6)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    AT3G05970 (LACS6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ath01004]
    AT3G05970 (LACS6)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ath04147]
    AT3G05970 (LACS6)
Enzymes [BR:ath01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     AT3G05970 (LACS6)
Lipid biosynthesis proteins [BR:ath01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   AT3G05970 (LACS6)
Exosome [BR:ath04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   AT3G05970 (LACS6)
  Exosomal proteins of breast cancer cells
   AT3G05970 (LACS6)
SSDB
Motif
Pfam: AMP-binding AMP-binding_C
Other DBs
NCBI-GeneID: 819767
NCBI-ProteinID: NP_566265
TAIR: AT3G05970
UniProt: Q8LPS1 A0A5S9X9I0
LinkDB
Position
3:complement(1786279..1791887)
AA seq 701 aa
MDSSSSSSSAAARRRINAIHSHLVTSSRSSPLLRSNPTAGEFCLDNGYSVVLPEKLNTGS
WNVYRSAKSPFKLVSRFPDHPDIATLHDNFEHAVHDFRDYKYLGTRVRVDGTVGDYKWMT
YGEAGTARTALGSGLVHHGIPMGSSVGIYFINRPEWLIVDHACSSYSYVSVPLYDTLGPD
AVKFIVNHATVQAIFCVAETLNSLLSCLSEMPSVRLVVVVGGLIESLPSLPSSSGVKVVS
YSVLLNQGRSNPQRFFPPKPDDVATICYTSGTTGTPKGVVLTHANLIANVAGSSFSVKFF
SSDVYISYLPLAHIYERANQILTVYFGVAVGFYQGDNMKLLDDLAALRPTVFSSVPRLYN
RIYAGIINAVKTSGGLKERLFNAAYNAKKQALLNGKSASPIWDRLVFNKIKDRLGGRVRF
MTSGASPLSPEVMEFLKVCFGGRVTEGYGMTETSCVISGMDEGDNLTGHVGSPNPACEVK
LVDVPEMNYTSADQPHPRGEICVRGPIIFTGYYKDEIQTKEVIDEDGWLHTGDIGLWLPG
GRLKIIDRKKNIFKLAQGEYIAPEKIENVYAKCKFVGQCFIYGDSFNSSLVAVVSVDPDV
LKSWAASEGIKGGDLRELCNNPRVKAAVLSDMDTVGREAQLRGFEFAKAVTLVLEPFTLE
NGLLTPTFKIKRPQAKEYFAEAITNMYKELGASDPSANRGL
NT seq 2106 nt   +upstreamnt  +downstreamnt
atggattcttcttcttcgtcttcctccgccgccgcacgccgccgtatcaacgctatccac
tctcacctcgtcacctcttctcgctcttcccctctcctccgctccaatcccaccgccggc
gagttctgtcttgataatggctatagtgttgttcttcccgagaaactgaatactggcagt
tggaacgtctacagatctgcaaaatctccgttcaagctcgttagcagattcccagatcat
cctgacatcgctactctccatgacaattttgagcatgctgttcatgattttcgagattac
aagtatttaggaactcgtgttcgtgtcgacggaactgttggagactacaaatggatgaca
tatggagaagctggtacagcaagaactgctttaggttctggtttggttcatcacggaatc
cccatgggatcttctgttggaatttacttcatcaatcgcccagagtggctcattgttgat
catgcttgttcttcttattcttatgtgtctgttcctttgtatgatactcttggtcctgat
gctgtgaaatttattgtcaatcatgcaactgtgcaagccatattttgtgtggcagagact
ttaaactctttacttagctgtttgtctgagatgccaagtgtacgcctggtggtggttgtt
ggagggttaattgaatctttaccctcgcttccctcatcatcaggagtgaaagttgtatcc
tattcggtgttactgaatcagggtcgtagtaaccctcagcgattttttccaccaaaaccc
gatgatgttgcaaccatatgctatacaagcggaacaactgggacacccaagggagtcgta
ttaactcatgcaaacttgattgccaatgttgctggctccagctttagtgtgaagtttttc
tcttcagatgtttacatttcgtatcttccacttgctcacatttacgaacgagctaatcag
atcctaacagtgtactttggagttgctgttggattctaccaaggggacaatatgaaacta
ctggatgatttggctgctctgagacctactgtatttagcagtgtccctcgattatacaat
agaatatatgctggtatcattaatgcagtaaaaacctctggtggtctgaaagagagactc
ttcaatgctgcctataatgcaaagaagcaggctctcttgaatggaaagagtgcttctccc
atatgggacaggttggtatttaataaaataaaggacagacttggagggcgggttcgtttt
atgacgtctggtgcttcacctctctctcctgaagtgatggaatttttgaaagtatgcttt
ggaggaagggtaacagagggatatggaatgactgaaacatcttgtgttataagtggaatg
gacgagggtgataacctcactggacatgttggctctcctaatccagcttgtgaagtaaag
cttgtggatgtcccagaaatgaactatacatcagcggatcagccccatccccgtggcgaa
atatgtgttaggggtcctatcatttttacaggctattacaaagatgaaattcaaacgaaa
gaggtgattgatgaagatggatggcttcacactggagatataggtctgtggctgccggga
ggacgtctaaaaattattgacagaaagaagaacatcttcaaattggcgcagggggagtat
atagctccagagaaaattgaaaacgtctatgccaaatgcaaatttgtgggccagtgcttc
atatatggtgatagctttaattcatcattggtagctgttgtatcggttgatccagatgtg
ctgaaaagctgggcagcttcagaaggcattaagggaggagatctgagagaattgtgtaat
aatccgagagtgaaagcagcagtactatctgacatggacactgttggaagagaagctcag
ttgagaggcttcgagtttgcaaaggctgtgacattggtgctggaaccatttactctggaa
aatggcttgttgactccgacgttcaagattaagagaccacaagcaaaggaatatttcgca
gaagcaataacaaacatgtacaaggagcttggtgcttctgatccctctgctaatagaggt
ttgtga

KEGG   Arabidopsis thaliana (thale cress): AT3G23790
Entry
AT3G23790         CDS       T00041                                 
Symbol
AAE16
Name
(RefSeq) AMP-dependent synthetase and ligase family protein
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00061  Fatty acid biosynthesis
ath00071  Fatty acid degradation
ath01100  Metabolic pathways
ath01212  Fatty acid metabolism
ath04146  Peroxisome
Module
ath_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    AT3G23790 (AAE16)
   00071 Fatty acid degradation
    AT3G23790 (AAE16)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    AT3G23790 (AAE16)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ath01004]
    AT3G23790 (AAE16)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ath04147]
    AT3G23790 (AAE16)
Enzymes [BR:ath01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     AT3G23790 (AAE16)
Lipid biosynthesis proteins [BR:ath01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   AT3G23790 (AAE16)
Exosome [BR:ath04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   AT3G23790 (AAE16)
  Exosomal proteins of breast cancer cells
   AT3G23790 (AAE16)
SSDB
Motif
Pfam: AMP-binding AMP-binding_C DUF5010
Other DBs
NCBI-GeneID: 821961
NCBI-ProteinID: NP_189021
TAIR: AT3G23790
UniProt: Q9LK39 A0A178VKD9
LinkDB
Position
3:8575051..8581331
AA seq 722 aa
MASTSLGASILVSHCSSAPEFQVSGMRLVFGYKAFGCRTSRRGFRVRCESKIQEKELRRC
SPFLERLSLPREAALSSNEWKSVPDIWRSSVEKYGDRVAVVDPYHDPPSTFTYRQLEQEI
LDFVEGLRVVGVKADEKIALFADNSCRWLVADQGIMATGAVNVVRGSRSSVEELLQIYCH
SESVALVVDNPEFFNRIAESFSYKAAPKFVILLWGEKSSLVTAGRHTPVYSYNEIKKFGQ
ERRAKFARSNDSGKYEYEYIDPDDIATIMYTSGTTGNPKGVMLTHQNLLHQIRNLSDFVP
AEAGERFLSMLPSWHAYERACEYFIFTCGVEQKYTSIRFLKDDLKRYQPHYLISVPLVYE
TLYSGIQKQISASSPARKFLALTLIKVSLAYTEMKRVYEGLCLTKNQKPPMYIVSLVDWL
WARVVAFFLWPLHMLAEKLVHRKIRSSIGITKAGVSGGGSLPMHVDKFFEAIGVNVQNGY
GLTETSPVVSARRLRCNVLGSVGHPIKDTEFKIVDHETGTVLPPGSKGIVKVRGPPVMKG
YYKNPLATKQVIDDDGWFNTGDMGWITPQHSTGRSRSCGGVIVLEGRAKDTIVLSTGENV
EPLEIEEAAMRSNLIQQIVVIGQDQRRLGAIVIPNKEAAEGAAKQKISPVDSEVNELSKE
TITSMVYEELRKWTSQCSFQVGPVLIVDEPFTIDNGLMTPTMKIRRDKVVDQYKNEIERL
YK
NT seq 2169 nt   +upstreamnt  +downstreamnt
atggcttcaacgtctctcggagcttcgattctcgtttctcactgctcctcagctcctgaa
tttcaagtttctgggatgagattggtgtttggttacaaggcttttggctgcagaacttca
cgcaggggatttcgagttcgctgcgaatccaagattcaggagaaggagttaaggcggtgt
tcgccattcttagaacgcttatcattgccaagggaggctgctttgagctctaatgaatgg
aagtctgttcctgatatttggagatcatctgtggagaagtacggtgacagagttgcggtg
gtagatccgtatcatgacccgccttctacattcacgtacagacagttggaacaagaaatc
ttggactttgttgagggtttacgagtcgttggagtgaaagcagacgagaagattgcactt
tttgctgataactcctgtcgatggcttgttgcggatcaaggtataatggccacaggagca
gtcaatgttgttagaggatccagatcgtctgtggaagagttattgcagatatactgtcat
tcggaaagtgtagcccttgttgtggataaccctgagtttttcaatcgcattgcggagtca
ttttcttacaaggcagctccaaaatttgtgattcttctctggggggaaaaatcgtcgttg
gttacagcgggtaggcacacaccagtctatagttacaacgaaattaaaaagtttggacaa
gagagacgtgcaaaatttgcaagatctaatgattctgggaagtatgaatatgaatacatc
gatccagatgatatagccacaattatgtataccagtggaaccacaggaaatccaaaaggt
gttatgctcacacatcagaatttgttacaccagataagaaacttgtccgattttgtgcct
gcggaagctggggaaagatttctgagtatgttgccatcatggcatgcttatgaacgggct
tgtgaatacttcatatttacatgtggagttgagcaaaagtatacgtctataagattctta
aaggatgatctcaagcgttatcaaccacactatcttatttcagttcctttagtatatgag
acactctacagcgggattcaaaagcaaatttctgcaagctcccctgctcgtaaatttttg
gcacttacattgatcaaagtcagcctggcatatacggaaatgaaaagagtttatgagggt
ctttgtttgacaaaaaatcaaaagcctccaatgtatattgtttcgttggtggattggttg
tgggcgagagtagttgcatttttcctatggccattgcatatgttggctgaaaagcttgta
cacagaaaaattcgttcgtctattgggataacaaaggctggtgttagtggaggtggtagt
ttacctatgcatgttgacaagttttttgaggccatcggtgtgaatgtacaaaatgggtat
ggtttgacagaaacctcaccggttgtctctgcgcggaggcttaggtgtaacgttcttggc
tcagttgggcatcctattaaagatacagagttcaaaattgtagatcatgagactggtact
gttcttccacctggttcaaagggcattgtcaaagtcagaggcccaccggtgatgaaaggt
tactacaagaatccactggccaccaagcaggttatagatgacgatggatggttcaatact
ggagatatgggttggattactcctcagcactcaacaggacggagtcgtagctgtggaggt
gtcatcgttcttgaagggcgtgccaaggacactatcgtgctttccacaggtgaaaatgtg
gaaccattggagattgaagaagcggccatgagaagcaatttgattcaacaaatagtggtt
attggacaggatcaacgccgccttggagctattgttatcccaaacaaagaagcagcagaa
ggagcagcaaagcagaaaatttcacctgtagattctgaagtcaatgaacttagcaaggag
acgataacaagcatggtctatgaagaactaaggaaatggacgtcacaatgctcgttccaa
gttggaccagttctgatcgtggatgaaccattcacgatagacaacggtttaatgacaccg
acaatgaaaataagacgggacaaggtggttgatcaatacaagaatgaaatagaaagactc
tacaagtag

KEGG   Arabidopsis thaliana (thale cress): AT4G11030
Entry
AT4G11030         CDS       T00041                                 
Name
(RefSeq) AMP-dependent synthetase and ligase family protein
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00061  Fatty acid biosynthesis
ath00071  Fatty acid degradation
ath01100  Metabolic pathways
ath01212  Fatty acid metabolism
ath04146  Peroxisome
Module
ath_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    AT4G11030
   00071 Fatty acid degradation
    AT4G11030
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    AT4G11030
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ath01004]
    AT4G11030
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ath04147]
    AT4G11030
Enzymes [BR:ath01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     AT4G11030
Lipid biosynthesis proteins [BR:ath01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   AT4G11030
Exosome [BR:ath04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   AT4G11030
  Exosomal proteins of breast cancer cells
   AT4G11030
SSDB
Motif
Pfam: AMP-binding AMP-binding_C
Other DBs
NCBI-GeneID: 826704
NCBI-ProteinID: NP_192841
TAIR: AT4G11030
UniProt: Q9T009
LinkDB
Position
4:6738068..6742424
AA seq 666 aa
MTSQKRFIFEVEAAKEATDGNPSVGPVYRSTFAQNGFPNPIDGIQSCWDIFRTAVEKYPN
NRMLGRREISNGKAGKYVWKTYKEVYDIVIKLGNSLRSCGIKEGEKCGIYGINCCEWIIS
MEACNAHGLYCVPLYDTLGAGAVEFIISHAEVSIAFVEEKKIPELFKTCPNSTKYMKTVV
SFGGVKPEQKEEAEKLGLVIHSWDEFLKLGEGKQYELPIKKPSDICTIMYTSGTTGDPKG
VMISNESIVTITTGVMHFLGNVNASLSEKDVYISYLPLAHVFDRAIEECIIQVGGSIGFW
RGDVKLLIEDLGELKPSIFCAVPRVLDRVYTGLQQKLSGGGFFKKKVFDVAFSYKFGNMK
KGQSHVAASPFCDKLVFNKVKQGLGGNVRIILSGAAPLASHIESFLRVVACCNVLQGYGL
TESCAGTFATFPDELDMLGTVGPPVPNVDIRLESVPEMNYDALGSTPRGEICIRGKTLFS
GYYKREDLTKEVFIDGWLHTGDVGEWQPNGSMKIIDRKKNIFKLAQGEYVAVENLENVYS
QVEVIESIWVYGNSFESFLVAIANPAQQTLERWAVENGVNGDFNSICQNAKAKAFILGEL
VKTAKENKLKGFEIIKDVHLEPVAFDMERDLLTPTYKKKRPQLLKYYQNVIHEMYKTTKE
SLASGQ
NT seq 2001 nt   +upstreamnt  +downstreamnt
atgacgtcgcagaaaagattcatctttgaggtggaagccgctaaggaagccacagatgga
aatccctcggttggtcctgtctatcgtagtacttttgctcagaacggattcccgaacccg
atcgatggtatccaaagctgctgggatattttccgcacggctgttgagaagtatccaaac
aatcgaatgcttggtcgccgtgagatttcgaacgggaaggcaggaaagtacgtgtggaaa
acatacaaagaagtatacgacattgtcataaaacttggaaattctctacgtagttgcggg
attaaggagggagaaaaatgtggtatatatggtataaattgttgtgagtggatcattagc
atggaggcatgtaatgcacatggcctttattgtgtccctttatacgatacgttaggcgct
ggtgcagtggaattcatcatttctcatgcagaggtttcaattgctttcgtggaggagaag
aagatccctgagctttttaagacttgtccaaactcaacaaaatatatgaagactgttgtg
agctttggcggtgtcaaaccggaacaaaaagaagaagctgaaaaattgggattggtaata
cattcgtgggatgagtttttgaagctgggtgagggtaagcaatatgagcttcccattaaa
aagccaagcgacatatgcacgattatgtatactagcggaacaactggtgacccgaaggga
gttatgatttcaaatgaaagcattgttactataactactggagtgatgcatttcctaggg
aatgtgaatgcaagcctatctgagaaggatgtgtatatttcttatcttcctctcgcgcac
gtctttgatcgggcaatcgaggaatgtattattcaagtaggtggttcaattggtttctgg
cgcggggatgtcaaattgttgattgaagaccttggtgagctaaaaccaagtatcttttgc
gccgttcctcgtgtcctagatcgagtatacacaggactacagcagaaactatctggtggt
ggtttcttcaaaaagaaggtgtttgatgttgctttttcctataaatttggaaatatgaag
aaaggacagtctcatgtggcagcttctccattttgtgacaaacttgtattcaacaaggtt
aaacaaggacttggaggcaatgtgaggattattctgtctggagcggctcctctcgctagt
cacatagaatcttttctaagagttgttgcatgttgtaatgttctacaaggatatggtcta
actgagagttgtgctggaacttttgcaacgttcccagacgaactagacatgcttgggact
gttggtccacccgtgccaaacgtcgatatacgccttgaatctgtcccggaaatgaattat
gatgctcttggaagtactccgcgaggcgaaatatgcatacgaggaaaaactttattttca
gggtactacaaacgtgaagacctcacaaaagaggtttttatcgacggatggttgcacaca
ggtgatgttggtgagtggcaaccaaatggaagcatgaagataattgaccggaaaaagaac
atcttcaaactcgcgcaaggagagtatgtcgctgttgagaatttagaaaatgtctacagt
caagtagaagttattgaatcgatatgggtatatggaaacagctttgagtccttccttgtc
gcaatcgctaacccggcccaacaaactcttgaacgatgggctgtggagaatggagtgaat
ggagacttcaactccatctgccaaaacgcaaaggcaaaagcattcatacttggagaactc
gttaaaacagccaaagagaacaagttgaagggttttgagatcataaaagatgttcatctg
gaaccagtggcgttcgacatggaacgagaccttcttactccaacctacaaaaagaagagg
cctcaattgctcaaatactatcagaatgtgatccatgaaatgtacaagacaacaaaggaa
agtctagcttccggacagtaa

KEGG   Arabidopsis thaliana (thale cress): AT4G14070
Entry
AT4G14070         CDS       T00041                                 
Symbol
AAE15
Name
(RefSeq) acyl-activating enzyme 15
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00061  Fatty acid biosynthesis
ath00071  Fatty acid degradation
ath01100  Metabolic pathways
ath01212  Fatty acid metabolism
ath04146  Peroxisome
Module
ath_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    AT4G14070 (AAE15)
   00071 Fatty acid degradation
    AT4G14070 (AAE15)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    AT4G14070 (AAE15)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ath01004]
    AT4G14070 (AAE15)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ath04147]
    AT4G14070 (AAE15)
Enzymes [BR:ath01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     AT4G14070 (AAE15)
Lipid biosynthesis proteins [BR:ath01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   AT4G14070 (AAE15)
Exosome [BR:ath04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   AT4G14070 (AAE15)
  Exosomal proteins of breast cancer cells
   AT4G14070 (AAE15)
SSDB
Motif
Pfam: AMP-binding AMP-binding_C CxC3
Other DBs
NCBI-GeneID: 827043
NCBI-ProteinID: NP_193143
TAIR: AT4G14070
UniProt: Q8W471
LinkDB
Position
4:complement(8111944..8118188)
AA seq 727 aa
MQIRLKPDYSFFIASSSTMASTSSLGPSTLLSYGSPSRQFPDFGFRLISGHESVRIPSFR
RFRVHCESKEKEVKPSSPFLESSSFSGDAALRSSEWKAVPDIWRSSAEKYGDRVALVDPY
HDPPLKLTYKQLEQEILDFAEGLRVLGVKADEKIALFADNSCRWLVSDQGIMATGAVNVV
RGSRSSVEELLQIYRHSESVAIVVDNPEFFNRIAESFTSKASLRFLILLWGEKSSLVTQG
MQIPVYSYAEIINQGQESRAKLSASNDTRSYRNQFIDSDDTAAIMYTSGTTGNPKGVMLT
HRNLLHQIKHLSKYVPAQAGDKFLSMLPSWHAYERASEYFIFTCGVEQMYTSIRYLKDDL
KRYQPNYIVSVPLVYETLYSGIQKQISASSAGRKFLALTLIKVSMAYMEMKRIYEGMCLT
KEQKPPMYIVAFVDWLWARVIAALLWPLHMLAKKLIYKKIHSSIGISKAGISGGGSLPIH
VDKFFEAIGVILQNGYGLTETSPVVCARTLSCNVLGSAGHPMHGTEFKIVDPETNNVLPP
GSKGIIKVRGPQVMKGYYKNPSTTKQVLNESGWFNTGDTGWIAPHHSKGRSRHCGGVIVL
EGRAKDTIVLSTGENVEPLEIEEAAMRSRVIEQIVVIGQDRRRLGAIIIPNKEEAQRVDP
ETSKETLKSLVYQELRKWTSECSFQVGPVLIVDDPFTIDNGLMTPTMKIRRDMVVAKYKE
EIDQLYS
NT seq 2184 nt   +upstreamnt  +downstreamnt
atgcaaattcgtctgaaacctgattattccttcttcatcgcctcttcctcaacgatggct
tcgacttcttctttgggaccttctacactactctcttacggttctccttctcgtcagttt
cctgattttgggttcagattgatttcgggtcacgaaagtgttcgaattccatcattccgg
cgatttcgggttcactgcgagtcaaaggaaaaagaagtgaagccgtcttctccatttctt
gaaagctcctcgttttcgggagatgctgctttgcgctctagtgaatggaaggctgttcct
gatatttggagatcatctgcagaaaagtatggtgatagagttgcattggtggatccttat
catgatcctcctttgaaactgacgtacaagcagttggaacaagaaattttggactttgct
gagggcttacgagttcttggagtgaaagcagatgagaagattgcactttttgctgataac
tcctgccgatggcttgtttcagatcaaggtataatggccacaggggcagtcaatgttgtc
agaggatctaggtcctctgttgaagagttactgcagatataccgtcattctgaaagcgta
gccattgttgtggataatcctgagtttttcaaccgcattgctgagtcatttacgtcaaag
gcatctctgagatttttgatacttctctggggtgagaaatcatcactggtcacacagggg
atgcagattccagtttacagttatgcagaaattataaaccaaggacaggagagtcgtgca
aaattatcagcatctaatgataccaggagctatagaaatcaattcatcgattcagatgat
acagctgcaattatgtataccagtggtaccacgggaaatccaaaaggcgttatgcttaca
catcggaatctcttacaccagataaaacatttatccaaatatgtacctgctcaagctggg
gataaatttctaagcatgctaccatcatggcatgcctatgaacgtgctagtgaatacttc
atattcacttgtggagttgagcaaatgtatacatctataagatacttaaaggatgatcta
aagcggtaccaaccgaactatattgtgtccgttcctctagtatatgagacactttacagt
gggattcaaaagcaaatttctgcaagttctgctggccgtaaatttctagcacttacattg
atcaaagtcagtatggcatatatggagatgaaaaggatatatgagggtatgtgtctgaca
aaagagcaaaagcctccaatgtatattgttgcttttgtggattggttgtgggcgagagta
attgctgccttgttgtggccattacatatgttggccaaaaagcttatctacaagaaaatt
cattcgtctattgggatatcgaaggctggtattagcggaggtggtagtttacccattcat
gttgacaagttttttgaggccatcggtgtgattctacaaaatggttatggtttgacagag
acctcacctgttgtctgtgcacggacacttagctgcaatgttcttggctcagctgggcat
ccaatgcatggtacagaattcaaaattgtagatcctgagactaataatgtactccctcct
ggttcaaagggcattatcaaagtcagaggtccacaggttatgaagggttattataagaat
ccatcgactacaaagcaagttctaaatgagagtggatggttcaatacaggagacaccggt
tggattgctcctcatcactcaaaagggcggagtcgccactgtggaggtgtcattgttctt
gaaggccgtgcaaaagacacaattgtactttccacaggtgaaaatgtggaaccgttggag
attgaagaagccgccatgagaagcagggtgattgaacaaattgttgttattggacaggac
cgacgtcgccttggagctatcattatcccaaacaaagaggaagcacaaagagtagatcct
gaaacatccaaagaaacactaaagagcttggtctaccaagaactgagaaaatggacatca
gaatgttcgtttcaagtcggaccagtcttgatcgtcgacgaccctttcacgatagacaac
gggttaatgacaccaactatgaagattagacgggacatggtcgtggctaaatacaaagag
gagattgatcaactctacagttaa

KEGG   Arabidopsis thaliana (thale cress): AT4G23850
Entry
AT4G23850         CDS       T00041                                 
Symbol
LACS4
Name
(RefSeq) AMP-dependent synthetase and ligase family protein
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00061  Fatty acid biosynthesis
ath00071  Fatty acid degradation
ath01100  Metabolic pathways
ath01212  Fatty acid metabolism
ath04146  Peroxisome
Module
ath_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    AT4G23850 (LACS4)
   00071 Fatty acid degradation
    AT4G23850 (LACS4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    AT4G23850 (LACS4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ath01004]
    AT4G23850 (LACS4)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ath04147]
    AT4G23850 (LACS4)
Enzymes [BR:ath01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     AT4G23850 (LACS4)
Lipid biosynthesis proteins [BR:ath01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   AT4G23850 (LACS4)
Exosome [BR:ath04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   AT4G23850 (LACS4)
  Exosomal proteins of breast cancer cells
   AT4G23850 (LACS4)
SSDB
Motif
Pfam: AMP-binding AMP-binding_C EIAV_GP90
Other DBs
NCBI-GeneID: 828484
NCBI-ProteinID: NP_194116
TAIR: AT4G23850
UniProt: Q9T0A0
LinkDB
Position
4:complement(12403454..12408421)
AA seq 666 aa
MSQQKKYIFQVEEGKEGSDGRPSVGPVYRSIFAKDGFPDPIEGMDSCWDVFRMSVEKYPN
NPMLGRREIVDGKPGKYVWQTYQEVYDIVMKLGNSLRSVGVKDEAKCGIYGANSPEWIIS
MEACNAHGLYCVPLYDTLGADAVEFIISHSEVSIVFVEEKKISELFKTCPNSTEYMKTVV
SFGGVSREQKEEAETFGLVIYAWDEFLKLGEGKQYDLPIKKKSDICTIMYTSGTTGDPKG
VMISNESIVTLIAGVIRLLKSANEALTVKDVYLSYLPLAHIFDRVIEECFIQHGAAIGFW
RGDVKLLIEDLAELKPTIFCAVPRVLDRVYSGLQKKLSDGGFLKKFIFDSAFSYKFGYMK
KGQSHVEASPLFDKLVFSKVKQGLGGNVRIILSGAAPLASHVESFLRVVACCHVLQGYGL
TESCAGTFVSLPDELGMLGTVGPPVPNVDIRLESVPEMEYDALASTARGEICIRGKTLFS
GYYKREDLTKEVLIDGWLHTGDVGEWQPDGSMKIIDRKKNIFKLSQGEYVAVENIENIYG
EVQAVDSVWVYGNSFESFLIAIANPNQHILERWAAENGVSGDYDALCQNEKAKEFILGEL
VKMAKEKKMKGFEIIKAIHLDPVPFDMERDLLTPTFKKKRPQLLKYYQSVIDEMYKTINA
KFASRG
NT seq 2001 nt   +upstreamnt  +downstreamnt
atgtcgcagcagaagaaatacatcttccaagttgaagaaggcaaagaaggtagcgatgga
agaccatcagttggtccagtgtaccggagtatctttgccaaggacggatttcccgacccg
atcgaaggaatggatagttgttgggatgttttccgcatgtctgttgagaagtatccaaac
aatccaatgctgggacgccgcgagattgtagatggaaagccgggtaagtatgtctggcaa
acataccaagaagtctacgacattgtcatgaaacttggaaattctctcagaagtgttgga
gttaaggacgaagcaaaatgtggtatctatggtgcaaattctcctgagtggattatcagc
atggaggcttgtaatgcacatggactctattgtgtaccgttatatgatacactaggtgct
gatgctgtggaattcatcatttcccattcagaggtttcaattgtctttgtggaagagaag
aagatctctgagttgttcaagacatgcccaaactcgacagagtacatgaaaactgttgtg
agcttcgggggtgtctcacgtgaacaaaaagaagaagctgaaacttttgggttggttata
tatgcttgggatgaatttttgaagctgggtgaaggaaagcaatatgatctcccaatcaaa
aagaaaagcgacatttgcacgattatgtatacgagtggaaccactggtgacccaaaggga
gtgatgatatctaacgaaagcattgtgactctaatcgctggagtgatccgtctactgaaa
agtgctaacgaggctctgactgtgaaagatgtgtatctttcttatcttcctcttgcccac
atctttgaccgagttatcgaggagtgtttcattcaacatggtgctgcaattggcttctgg
cgaggggatgtaaaattgttgatcgaagaccttgctgagcttaaaccaactattttttgt
gctgtacctcgtgtcctggatagagtatactcaggtcttcagaagaagctttctgatggt
ggattcttaaaaaagttcatatttgattctgcattttcctataaatttggttatatgaag
aagggacagtctcatgtggaggcctctccactttttgacaaacttgtgttcagcaaggtt
aaacaaggactcggaggcaatgtgaggattattctatctggagctgctcctcttgctagt
cacgtagagtcatttctaagagtggtggcatgctgtcatgttctccaaggatacggtctt
actgaaagctgtgctggaacttttgtctcgctgccagatgaactaggtatgctcggcaca
gttggtccaccagtgccaaacgttgatatacgccttgaatccgtccccgagatggaatat
gatgctcttgcgagtactgcacgtggtgaaatctgcattcggggaaagacccttttctct
ggttactacaaacgtgaagatctcacgaaagaggttctcattgatggatggctgcacaca
ggtgatgttggtgagtggcaaccagatggaagcatgaagataattgacaggaagaagaat
atctttaaactctcacaaggagagtatgttgcggtggagaacatagaaaacatatacggt
gaagtacaagctgttgattccgtgtgggtgtacggtaacagctttgagtccttcctaata
gctatcgccaacccaaaccagcatatccttgaacgctgggctgcagaaaacggtgtgagt
ggtgactatgacgctctctgtcaaaatgaaaaggcaaaggaattcattctcggagaactt
gttaaaatggccaaagagaaaaagatgaaagggttcgagatcatcaaggcgattcatctt
gacccagtgccatttgacatggaacgagatcttcttacgccgaccttcaaaaagaaaagg
cctcagttgctgaaatactaccagagtgtgatcgacgaaatgtacaagaccataaatgca
aaatttgcttccagagggtag

DBGET integrated database retrieval system