KEGG   Arabidopsis thaliana (thale cress): AT1G53310Help
Entry
AT1G53310         CDS       T00041                                 

Gene name
PPC1
Definition
(RefSeq) phosphoenolpyruvate carboxylase 1
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00620  Pyruvate metabolism
ath00710  Carbon fixation in photosynthetic organisms
ath01100  Metabolic pathways
ath01200  Carbon metabolism
Module
ath_M00168  CAM (Crassulacean acid metabolism), dark
ath_M00170  C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
ath_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
ath_M00172  C4-dicarboxylic acid cycle, NADP - malic enzyme type
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AT1G53310 (PPC1)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    AT1G53310 (PPC1)
Enzymes [BR:ath01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     AT1G53310 (PPC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-GeneID: 841765
NCBI-ProteinID: NP_001031178
MIPS: AT1G53310.1
TAIR: AT1G53310
Araport: AT1G53310
UniProt: Q9MAH0 A0A178WJH6
LinkDB All DBs
Position
1
AA seq 967 aa AA seqDB search
MANRKLEKMASIDVHLRQLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGEDLRETVQEL
YEHSAEYEGKHEPKKLEELGSVLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRIK
KLKKGDFVDESSATTESDLEETFKKLVGDLNKSPEEIFDALKNQTVDLVLTAHPTQSVRR
SLLQKHGRIRDCLAQLYAKDITPDDKQELDEALQREIQAAFRTDEIKRTPPTPQDEMRAG
MSYFHETIWKGVPKFLRRVDTALKNIGIEERVPYNAPLIQFSSWMGGDRDGNPRVTPEVT
RDVCLLARMMAATMYFNQIEDLMFEMSMWRCNDELRARADEVHANSRKDAAKHYIEFWKS
IPTTEPYRVILGDVRDKLYHTRERAHQLLSNGHSDVPVEATFINLEQFLEPLELCYRSLC
SCGDRPIADGSLLDFLRQVSTFGLSLVRLDIRQESDRHTDVLDAITTHLDIGSYREWSEE
RRQEWLLSELSGKRPLFGSDLPKTEEIADVLDTFHVIAELPADSFGAYIISMATAPSDVL
AVELLQRECRVKQPLRVVPLFEKLADLEAAPAAVARLFSVDWYKNRINGKQEVMIGYSDS
GKDAGRLSAAWQLYKAQEELVKVAKEYGVKLTMFHGRGGTVGRGGGPTHLAILSQPPDTI
NGSLRVTVQGEVIEQSFGEEHLCFRTLQRFTAATLEHGMRPPISPKPEWRALLDEMAVVA
TEEYRSVVFQEPRFVEYFRLATPELEYGRMNIGSRPSKRKPSGGIESLRAIPWIFAWTQT
RFHLPVWLGFGSAIRHVIEKDVRNLHMLQDMYQHWPFFRVTIDLIEMVFAKGDPGIAALY
DKLLVSEELWPFGEKLRANFEETKKLILQTAGHKDLLEGDPYLKQRLRLRDSYITTLNVC
QAYTLKRIRDPSYHVTLRPHISKEIAESSKPAKELIELNPTSEYAPGLEDTLILTMKGIA
AGLQNTG
NT seq 2904 nt NT seq  +upstreamnt  +downstreamnt
atggcgaatcggaagttagagaagatggcatcgattgatgttcatcttcgtcaactggtt
cctggcaaagttagtgaagacgacaagcttgttgagtatgatgctttgcttctagatcgg
tttctcgatatcctccaggatttgcacggtgaagatctccgtgaaactgttcaagagctt
tatgagcattctgcagaatacgaagggaagcatgaacctaagaagctagaggagctaggg
agtgtgctaacgagtttagatccaggagattccattgttatcgctaaagctttctctcat
atgcttaacttagccaatttggctgaggaagtgcagattgcttatcgccgtaggatcaag
aagctgaagaaaggtgattttgttgatgagagctctgctactactgaatctgatcttgaa
gaaactttcaagaagcttgttggagatctgaacaagtctcctgaagagatctttgatgct
ctcaagaatcagactgtggatttggttttgactgctcatcctactcagtctgtgagaaga
tcattgcttcagaaacatgggaggataagagactgtctggctcaactatatgctaaggat
attactcctgatgacaagcaagagctcgatgaggctcttcagagagagattcaagctgca
ttccgaacagatgaaatcaaaagaacaccacctactcctcaagatgagatgagagcggga
atgagttatttccatgaaactatctggaaaggtgttcctaagtttctgcgccgtgttgac
acggctttgaaaaacatagggatcgaagaacgtgttccatataatgctccattgattcag
ttctcttcttggatgggtggtgatcgtgacggtaacccaagggttacacctgaagtcacc
agagatgtttgcttgttagctagaatgatggctgctactatgtactttaaccaaatcgaa
gatcttatgtttgagatgtctatgtggcgttgcaatgacgagctgcgtgcgcgagctgat
gaagttcatgcaaattcgaggaaagatgctgcaaaacattacatagaattctggaagtca
attcctacaactgagccataccgtgtgattcttggcgatgtaagggacaagctttatcac
acacgtgaacgcgctcatcaactgctcagcaatggacactctgatgtccctgtagaggct
actttcattaacttggaacagttcttggaacctcttgagctctgttaccgatctctgtgt
tcatgtggtgatcgtccaatagcagatggaagccttcttgatttcttgaggcaagtctca
acctttgggctctctcttgtgagacttgacataaggcaagaatctgaccgccacactgat
gtattggatgctatcaccacgcatttagatatcggatcctacagagagtggtctgaagaa
cgccgccaagaatggcttttatctgagctaagtggcaaacgtccgcttttcggttctgat
cttcctaaaaccgaagaaatagctgatgttctggacacgtttcatgtcatagccgagcta
ccagcagatagctttggtgcttacattatctctatggcaactgcaccttctgatgtatta
gctgttgagcttttacagcgtgaatgccgagtgaaacagcctttgagagttgttccgctc
tttgagaagctagcagatctggaagcagctcctgctgcagttgctaggctcttttctgtt
gattggtacaaaaaccgaattaacggtaagcaagaggttatgattggttattcggattca
ggaaaagatgctggacggttatctgctgcttggcagttatacaaagctcaagaagagctt
gtgaaggttgctaaagagtacggtgtgaagctaacaatgtttcacggtcgtggtggcacg
gtcggaagaggaggtggaccaacccatcttgctatattgtctcagcctccggatactatt
aacggttccctccgtgtcacagttcaaggtgaagtcatcgagcaatcgtttggtgaagag
cacttatgctttagaacacttcagcgtttcacagctgctacactcgagcacggtatgcgt
cctccaatttcgcctaaaccagaatggcgcgctttgctggatgaaatggcggttgttgca
accgaggagtatcgctcagttgtgttccaagaacctcggtttgtcgagtacttccgcctc
gctacaccggaactggagtatggacgtatgaatatcggaagcagaccttcgaagcgtaaa
ccaagcggtggcattgaatctctccgtgcaattccatggatcttcgcttggactcaaaca
agattccatcttcctgtatggcttggattcggatcagcaattagacatgtgatcgaaaaa
gacgtcaggaacctccatatgctccaagatatgtaccaacactggcctttctttagagtc
accattgatctaatcgaaatggtgttcgctaaaggagatcctggtattgctgctttgtac
gataagcttcttgtttcagaggaactctggccttttggtgagaaactcagagctaacttc
gaagaaaccaagaaactcatcctccagaccgctggacacaaagatcttcttgaaggtgat
ccttacttgaaacagagactgagacttcgtgattcttacattacaactctcaatgtctgt
caagcttacacattgaagagaatccgtgatccgagttaccatgtgactctgcgaccacac
atttctaaggagatagcggaatcgagcaaaccagcaaaagaactcatcgagcttaacccg
actagcgaatacgcgccaggacttgaagatacactcatcttgacgatgaagggtattgct
gctggtctacaaaacaccggttaa

DBGET integrated database retrieval system