KEGG   Arabidopsis thaliana (thale cress): AT1G64400
Entry
AT1G64400         CDS       T00041                                 

Symbol
LACS3
Name
(RefSeq) AMP-dependent synthetase and ligase family protein
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00061  Fatty acid biosynthesis
ath00071  Fatty acid degradation
ath01100  Metabolic pathways
ath01212  Fatty acid metabolism
ath04146  Peroxisome
Module
ath_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    AT1G64400 (LACS3)
   00071 Fatty acid degradation
    AT1G64400 (LACS3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    AT1G64400 (LACS3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ath01004]
    AT1G64400 (LACS3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ath04147]
    AT1G64400 (LACS3)
Enzymes [BR:ath01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     AT1G64400 (LACS3)
Lipid biosynthesis proteins [BR:ath01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   AT1G64400 (LACS3)
Exosome [BR:ath04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   AT1G64400 (LACS3)
  Exosomal proteins of breast cancer cells
   AT1G64400 (LACS3)
SSDB
Motif
Pfam: AMP-binding AMP-binding_C
Other DBs
NCBI-GeneID: 842748
NCBI-ProteinID: NP_176622
TAIR: AT1G64400
UniProt: Q9C7W4
LinkDB
Position
1:complement(23915570..23919835)
AA seq 665 aa
MATGRYIVEVEKGKQGVDGGSPSVGPVYRSIYAKDGFPEPPDDLVSAWDIFRLSVEKSPN
NPMLGRREIVDGKAGKYVWQTYKEVHNVVIKLGNSIRTIGVGKGDKCGIYGANSPEWIIS
MEACNAHGLYCVPLYDTLGAGAIEFIICHAEVSLAFAEENKISELLKTAPKSTKYLKYIV
SFGEVTNNQRVEAERHRLTIYSWDQFLKLGEGKHYELPEKRRSDVCTIMYTSGTTGDPKG
VLLTNESIIHLLEGVKKLLKTIDEELTSKDVYLSYLPLAHIFDRVIEELCIYEAASIGFW
RGDVKILIEDIAALKPTVFCAVPRVLERIYTGLQQKLSDGGFVKKKLFNFAFKYKHKNME
KGQPHEQASPIADKIVFKKVKEGLGGNVRLILSGAAPLAAHIESFLRVVACAHVLQGYGL
TESCGGTFVSIPNELSMLGTVGPPVPNVDIRLESVPEMGYDALASNPRGEICIRGKTLFS
GYYKREDLTQEVFIDGWLHTGDVGEWQPDGAMKIIDRKKNIFKLSQGEYVAVENLENIYS
HVAAIESIWVYGNSYESYLVAVVCPSKIQIEHWAKEHKVSGDFESICRNQKTKEFVLGEF
NRVAKDKKLKGFELIKGVHLDTVPFDMERDLITPSYKMKRPQLLKYYQKEIDEMYKKNRE
VQLRV
NT seq 1998 nt   +upstreamnt  +downstreamnt
atggcgactggtcgatacatcgttgaggttgagaagggaaagcaaggcgttgatggagga
agtccatcggtcggtccagtgtaccggagtatctatgctaaagacggttttcctgaaccg
cctgatgatctcgtcagtgcatgggatattttccgtttatctgtggagaaatctccaaat
aatcctatgcttggtcgtagagaaatagttgatggaaaagctgggaaatatgtatggcaa
acttacaaagaagtacataatgtagtgattaagcttggaaactctatcagaactattgga
gttggaaaaggagataaatgcggtatttatggcgccaatagtcctgaatggattataagc
atggaggcttgcaatgctcatggactctactgtgtacctttatatgacactctaggtgct
ggagcaatagaattcatcatttgtcatgctgaggtctcacttgcttttgctgaggagaac
aagatttctgagttattgaagacagctccaaaatcaactaaatatttgaagtatattgtg
agctttggtgaggttacaaataatcagagagtagaagctgagaggcacagattaacaata
tattcatgggaccaattcttgaagctaggcgagggtaaacattatgaattaccagagaag
aggagaagcgatgtttgcaccataatgtatacaagtggcacaactggtgatcctaaagga
gtattgcttacaaatgagagcattattcatctccttgaaggtgttaaaaaattgcttaaa
actattgatgaagagttaaccagtaaagatgtatatctctcatatctacctctggctcat
atcttcgatcgtgtgattgaggagctgtgtatttatgaagcagcctctatcggattctgg
cgaggggatgttaagatattgatagaagacattgctgcattgaaaccgactgttttctgc
gctgttcctcgcgttctagagagaatatacaccggtcttcagcagaaactttctgatggt
ggttttgtaaagaagaaattattcaactttgcattcaaatacaaacataaaaacatggag
aaagggcagcctcatgaacaagcatctccaatagctgacaaaattgtatttaaaaaggta
aaagaagggttgggaggaaacgtgcgtcttatcctctcaggagcagctcctcttgcagct
cacatcgaatctttccttcgagttgtcgcgtgtgctcatgttttgcaaggatacggtcta
acagagagttgtggtgggacttttgtgtccattccaaacgagctttcaatgcttggaacg
gttggtccaccggttccaaacgttgacataaggctagagtcagttccagagatgggttat
gacgctcttgcaagcaatccacgtggagagatttgcatcaggggaaagactttgttctct
ggatactacaaacgtgaagatctcactcaagaagtcttcattgatggatggcttcacact
ggtgatgtcggtgagtggcaaccagatggagccatgaagatcatcgaccgtaagaagaac
atctttaaactgtctcaaggagaatacgttgccgttgagaacttggagaacatatacagt
catgtcgccgccattgaatcgatatgggtatatggaaacagctatgagtcttacttagtg
gctgtggtatgtccaagcaagatccagatcgagcattgggccaaagaacacaaagtttca
ggagactttgagtctatctgccgaaaccaaaagactaaagagtttgtccttggagagttc
aacagagtagccaaagacaaaaagctgaagggatttgagctgatcaaaggtgttcatttg
gacacagtcccgttcgacatggaaagagatctcatcactccttcttacaagatgaaaaga
cctcagcttctcaagtactatcagaaagagattgatgaaatgtataagaaaaacagagaa
gtgcagctacgagtgtaa

DBGET integrated database retrieval system