KEGG   Arabidopsis thaliana (thale cress): AT1G66730Help
Entry
AT1G66730         CDS       T00041                                 

Gene name
LIG6
Definition
(RefSeq) DNA LIGASE 6
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DRMBL DNA_ligase_A_C RMMBL Lactamase_B_2
Motif
Other DBs
NCBI-GeneID: 842991
NCBI-ProteinID: NP_176845
MIPS: AT1G66730.1
TAIR: AT1G66730
Araport: AT1G66730
UniProt: F4HPZ9
LinkDB All DBs
Position
1
AA seq 1396 aa AA seqDB search
MASDSAGATISGNFSNSDNSETLNLNTTKLYSSAISSISPQFPSPKPTSSCPSIPNSKRI
PNTNFIVDLFRLPHQSSSVAFFLSHFHSDHYSGLSSSWSKGIIYCSHKTARLVAEILQVP
SQFVFALPMNQMVKIDGSEVVLIEANHCPGAVQFLFKVKLESSGFEKYVHTGDFRFCDEM
RFDPFLNGFVGCDGVFLDTTYCNPKFVFPSQEESVGYVVSVIDKISEEKVLFLVATYVVG
KEKILVEIARRCKRKIVVDARKMSMLSVLGCGEEGMFTEDENESDVHVVGWNVLGETWPY
FRPNFVKMNEIMVEKGYDKVVGFVPTGWTYEVKRNKFAVRFKDSMEIHLVPYSEHSNYDE
LREFIKFLKPKRVIPTVGVDIEKFDCKEVNKMQKHFSGLVDEMANKKDFLLGFYRQSYQK
NEKSDVDVVSHSAEVYEEEEKNACEDGGENVPSSRGPILHDTTPSSDSRLLIKLRDSLPA
WVTEEQMLDLIKKHAGNPVDIVSNFYEYEAELYKQASLPTPSLNNQAVLFDDDVTDLQPN
PVKGICPDVQAIQKGFDLPRKMNLTKGTISPGKRGKSSGSKSNKKAKKDPKSKPVGPGQP
TLFKFFNKVLDGGSNSVSVGSETEECNTDKKMVHIDASEAYKEVTDQFIDIVNGSESLRD
YAASIIDEAKGDISRALNIYYSKPREIPGDHAGERGLSSKTIQYPKCSEACSSQEDKKAS
ENSGHAVNICVQTSAEESVDKNYVSLPPEKYQPKEHACWREGQPAPYIHLVRTFASVESE
KGKIKAMSMLCNMFRSLFALSPEDVLPAVYLCTNKIAADHENIELNIGGSLISSALEEAC
GISRSTVRDMYNSLGDLGDVAQLCRQTQKLLVPPPPLLVRDVFSTLRKISVQTGTGSTRL
KKNLIVKLMRSCREKEIKFLVRTLARNLRIGAMLRTVLPALGRAIVMNSFWNDHNKELSE
SCFREKLEGVSAAVVEAYNILPSLDVVVPSLMDKDIEFSTSTLSMVPGIPIKPMLAKIAK
GVQEFFNLSQEKAFTCEYKYDGQRAQIHKLLDGTVCIFSRNGDETTSRFPDLVDVIKQFS
CPAAETFMLDAEVVATDRINGNKLMSFQELSTRERGSKDALITTESIKVEVCVFVFDIMF
VNGEQLLALPLRERRRRLKEVFPETRPGYLEYAKEITVGAEEASLNNHDTLSRINAFLEE
AFQSSCEGIMVKSLDVNAGYCPTKRSDSWLKVKRDYVDGLGDTLDLVPIGAWYGNGRKAG
WYSPFLMACFNPETEEFQSVCRVMSGFSDAFYIEMKEFYSEDKILAKKPPYYRTGETPDM
WFSAEVVWEIRGADFTVSPVHSASLGLVHPSRGISVRFPRFISKVTDRNPEECSTATDIA
EMFHAQTRKMNITSQH
NT seq 4191 nt NT seq  +upstreamnt  +downstreamnt
atggcctctgattccgccggagccacaatctccggcaacttctcaaactccgacaactca
gaaaccctaaatctcaacactacgaaactctactcatcagcaatttcctctatctctcca
caattcccctcaccgaaaccaacatcttcatgtccttcaatccctaattcaaaacgaatc
cctaatactaacttcatcgtcgatctcttccgcctcccacaccaatcatcctccgtcgct
ttcttcctctcacatttccactccgatcactactccggtctctcctcttcctggtccaaa
ggaataatctactgctcacacaaaaccgctcgtctcgttgcagaaatccttcaagttcct
tcacaattcgttttcgctttacctatgaaccaaatggttaagatcgatggctctgaagtt
gtgttgattgaagctaatcattgtccaggagcggtacagtttttgtttaaagtcaaatta
gagagcagtggatttgaaaagtatgttcatactggagattttagattctgtgatgagatg
agatttgatccgtttcttaatggttttgttggttgtgatggtgtttttctcgatactact
tattgtaatcctaagtttgtttttccgagtcaagaagagtctgttggttatgttgttagt
gtgatagataagattagtgaggagaaggttttgtttcttgtagctacttatgttgttggt
aaagagaagattttggttgagattgctaggagatgtaagaggaaaatcgttgtcgatgcg
agaaagatgtcgatgttgtcggttttggggtgtggtgaggagggaatgtttactgaagat
gagaatgagagtgatgttcatgttgtggggtggaatgtgttgggtgagacttggccgtat
tttaggccgaattttgtgaagatgaatgagattatggttgagaaagggtatgataaggtt
gtaggttttgtgcctacagggtggacttatgaagtgaagcggaataagtttgcggttagg
tttaaagattcgatggagattcatcttgtaccgtatagtgagcattcgaattatgatgaa
cttagagagtttataaagttcctgaaacctaaaagagttattcctactgttggagttgat
attgagaagtttgattgcaaggaggttaataagatgcagaagcatttctctggattggtt
gatgagatggcaaacaagaaagattttttattgggtttctatcgtcagtcttaccagaag
aatgagaaaagtgatgtagatgttgtgtcacacagtgctgaggtttacgaagaggaagag
aaaaatgcatgtgaagacggtggagagaatgttccatcatctagaggacccatattgcat
gatacaactccaagtagtgattcaagattgctgataaaactacgtgattctttgcctgct
tgggtcactgaagagcagatgttagatctgattaagaagcatgctggtaatcccgtggat
atagtaagtaacttttatgaatatgaagcagagctttacaagcaagcctctcttcccacg
ccttccttgaataatcaggctgttttgtttgatgacgatgtaaccgacctccaacctaat
cctgtgaaaggcatttgtccagatgttcaagcaattcaaaaaggttttgacttaccaaga
aaaatgaatttaacaaagggtactatttctcctgggaagagaggcaaaagctcgggcagt
aagtcaaacaagaaggccaagaaagatccaaaatcaaaaccagttggtccagggcagcca
acactttttaagtttttcaataaggtcttagatggtggatctaattctgttagtgttggt
tcagagactgaagaatgcaatacagataaaaagatggtccacattgatgcttcagaagca
tacaaagaagtgacagatcaatttattgatattgttaacggttctgaatctttaagagat
tatgctgcttccatcattgatgaggctaaaggagatataagtagggcactgaacatctat
tatagcaaaccccgtgaaatacctggtgaccatgcaggtgagagaggactctctagcaaa
acaattcagtatccgaaatgttcagaagcatgctcctctcaggaggacaaaaaggcttca
gaaaattcaggacatgcagtcaacatatgcgtgcagacatcagcagaggaaagtgtagac
aagaattatgtatctctacctcctgaaaaatatcaacctaaagagcacgcttgttggagg
gagggacagcctgctccatatatccaccttgtccgaacatttgcttctgttgaaagtgaa
aagggaaagatcaaagctatgtctatgctttgcaacatgtttagaagcttgtttgctctc
tctccagaagatgttctgcccgctgtttatctttgcacaaataagattgccgctgaccat
gagaatattgagcttaacattggtggaagtctaatctcttctgcattggaagaagcatgt
ggaataagtcggtctactgtgagagatatgtataatagcttgggggatcttggggatgtt
gctcagctatgtcgacaaacgcaaaagctactggttcctccacctccacttctagttaga
gatgtgttttcaactctacgaaagataagtgtgcagacaggtactggaagtactaggcta
aagaaaaatctcatcgtgaagctaatgcgctcttgtagagagaaagagatcaaatttctt
gttagaacattggcccgtaatttaaggattggcgctatgttgagaactgttctacctgca
cttgggcgagcaatcgttatgaattctttctggaatgaccataataaagaactatcagaa
agctgtttcagggagaaacttgagggtgtttctgctgcagtagttgaggcttacaacatt
cttccatctctggacgtggttgttccttctctcatggacaaagacattgagttttcaacg
tcaactctgtcaatggtcccagggatacctataaaacccatgcttgcaaaaattgctaag
ggggttcaagaattttttaacctctcccaagaaaaggcctttacttgtgaatacaaatat
gatggccagcgcgcccagatccataagttacttgatggtactgtgtgtatcttttctcgg
aatggggacgaaacaacgtccagatttccggatctggttgatgtcataaaacagttttct
tgccctgccgctgagacattcatgttggacgcagaggtggttgccactgatagaataaat
ggaaacaaactcatgtcattccaagagttatcaacaagagagagagggagcaaagatgct
ttgataactacagaaagtattaaggttgaagtctgcgtcttcgtgtttgatattatgttt
gtcaatggagaacagctgttggctcttcccctccgtgagagacgaagacgtctaaaggag
gtcttccctgagactaggccaggttatcttgagtatgctaaggaaataactgtgggagca
gaagaagcgtctctgaataatcatgacacattgagtaggataaatgcttttcttgaagaa
gcatttcagtcatcttgtgaaggaatcatggtcaagtctttagatgtaaatgctggatac
tgccccacaaagcgctctgattcatggctcaaggttaagcgagattatgtagatggattg
ggcgatacattggatttagttcctattggtgcttggtatggcaatgggagaaaagcagga
tggtatagtccattccttatggcctgcttcaaccctgagactgaagaattccagagtgtc
tgccgtgtcatgtctggtttttctgatgccttttacatcgagatgaaagaattctactcg
gaggataagatccttgcgaaaaagccgccttactacagaacaggggagacacctgacatg
tggttttccgcagaggtagtttgggaaatcagaggtgctgatttcacagtctcgcctgtt
cacagtgccagtttaggtctcgtccatccatcgcgaggcatctctgttaggtttccgaga
tttatcagtaaagtgacagatagaaatcctgaagaatgtagtacggctacagatatcgca
gagatgtttcatgctcaaaccagaaaaatgaacatcacttctcaacattaa

DBGET integrated database retrieval system