KEGG   Arabidopsis thaliana (thale cress): AT1G68720
Entry
AT1G68720         CDS       T00041                                 

Symbol
TADA
Name
(RefSeq) tRNA arginine adenosine deaminase
  KO
K11991  tRNA(adenine34) deaminase [EC:3.5.4.33]
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
KEGG Orthology (KO) [BR:ath00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ath03016]
    AT1G68720 (TADA)
Enzymes [BR:ath01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.33  tRNA(adenine34) deaminase
     AT1G68720 (TADA)
Transfer RNA biogenesis [BR:ath03016]
 Prokaryotic type
  tRNA modification factors
   Deaminases
    AT1G68720 (TADA)
SSDB
Motif
Pfam: MafB19-deam dCMP_cyt_deam_1 Bd3614-deam SNAD4 NAD2 Inv-AAD DUF2162
Other DBs
NCBI-GeneID: 843202
NCBI-ProteinID: NP_177039
TAIR: AT1G68720
UniProt: Q9S7I0
LinkDB
Position
1:25804392..25809031
AA seq 1307 aa
MFNTYTNSLQWPIRSRNQQDYCSLLPERSESYKLSKAYTSSRCYCVSSRSSCCCCCSTPS
SSSFVKPKVLINPGFVLYGVRQSTLIQWPSFQRRLLVGGGRLMGCEVYSSCDGIRRKNRS
FKLRCLEESDECCGGRSCSDDVEAMISFLSEELIDEERKWNLVSRVKEKKKVGNVRKVSV
EGSNSYGNGRVSQRVKKPEGFGRRKEIKEDVKLNERYDCEHCGRRKKSSELESESRRGSK
LVTGEYIGKSYRGDEEREVRPRRRKSSSCSSYYSLASSGEFESDTEDQEEDVEIYRENVR
SSEKKVVDQSAKRLKSRKEASQMHSRKKRDESSTGVDSRYQKQIFEEGENSNQAVTLNQR
RRKKFSQTENRVSESTGNYEEDMEIHEVHVNDAETSSQNQKLFNEREDYRVHSIRNDSGN
ENIESSQHQLKERLETRYSSEDRVSEMRRRTKYSSSQEEGINVLQNFPEVTNNQQPLVEE
RISKQAGTRRTTEHISESSEIHDIDIRNTYVSQREDQIRNQEVHAGLVSGLQSERKQQDY
HIEHNPLQTTQSDRTSVSVSHTSDAVRYTEIQRKSEKRLIGQGSTTAVQSDSKVEKNGAQ
KEDSRLDHANSKKDGQTTLGLQSYQSKLSEEASSSQSSLMASRTKLQLVDLVSEEMQGSE
TTLIPPSSQLVSRRSGQSYRTGGVSIQEISHGTSESGYTTAFEHPRAGASVNSQSAGELM
GFTSHEDAMGSAHRLEQASEKYVGEFVKKAKHGVINPETEEQRAESNQLKRRDSRRSSGG
SGAKGPSDEMWVTDSAQGTPHPGATEGNAAVGNAIFKRNGRSLWNVIADIARLRWGSRAG
SPDSSAKPAGRSSPNESVSSATWFSGREHDGSSDDNTKGDKVLPQEAPSLHQVEVGQTSP
RSQSEYPGTTKLKQRSERHEGVVSSPSSTILEGGSVSNRMSSTSGNQIVGVDEEEGGNFE
FRLPETALTEVPMKLPSRNLIRSPPIKESSESSLTEASSDQNFTVGEGRRYPRMDAGQNP
LLFPGRNLRSPAVMEPPVPRPRMVSGSSSLREQVEQQQPLSAKSQEETGSVSADSALIQR
KLQRNKQVVRDSFEEWEEAYKVEAERRTVDEIFMREALVEAKKAADTWEVPVGAVLVHDG
KIIARGYNLVEELRDSTAHAEMICIREGSKALRSWRLADTTLYVTLEPCPMCAGAILQAR
VNTLVWGAPNKLLGADGSWIRLFPGGEGNGSEASEKPPPPVHPFHPKMTIRRGVLESECA
QTMQQFFQLRRKKKDKNSDPPTPTDHHHHHLPKLLNKMHQVLPFFCL
NT seq 3924 nt   +upstreamnt  +downstreamnt
atgttcaatacatacacaaactcacttcaatggccgattcgaagtagaaatcaacaagat
tactgctctttgctccctgagagatctgaaagttacaaactttcaaaagcatatacatct
tcgagatgttactgtgttagttctcgctcaagctgttgctgttgttgttcaacaccatct
tcttcttcatttgttaagcctaaggtattgataaaccctggatttgtgctttatggggtt
agacaatctacgcttattcagtggccttcgtttcaaaggaggttacttgtgggtggaggg
agacttatgggttgtgaggtttattcttcttgtgatggtataagaaggaaaaatcggagc
tttaagcttaggtgtttggaagaatctgatgaatgttgtggtggtagaagttgttcagat
gatgtagaagctatgatttcgtttttgagtgaggaattgatagatgaggagaggaagtgg
aatttagttagtagagttaaagagaagaagaaagtggggaatgtgagaaaggttagtgtt
gaaggaagtaatagttatggtaatgggagagtttctcaaagagtaaagaaacctgagggg
tttggtaggcgaaaggagattaaggaagatgtgaagttaaatgaaagatatgattgtgaa
cattgtgggaggagaaagaaaagttctgagttggagagtgaatctcggcgtggttctaaa
ttggttactggtgagtatattggaaaaagttataggggggatgaagaaagagaagttcgg
ccaagaaggagaaagagttcgagttgttcatcgtattattcccttgcttcttcaggggag
tttgagagtgatactgaagatcaggaggaggatgtagagatttatcgcgaaaacgtgaga
agttcagagaagaaggttgttgatcagtcagccaaaagattgaaatctagaaaggaagcc
tctcagatgcattcaaggaaaaagagagatgagagctctactggagtggattcaaggtat
cagaagcagatttttgaggaaggggaaaattcaaatcaggcagtgactttgaaccagcga
agaagaaaaaagtttagtcaaactgaaaatagagtgtctgaatctacgggaaattatgaa
gaagatatggaaattcatgaggtccatgtcaacgatgcagagaccagttcccaaaatcaa
aagctctttaatgaaagggaggactatagagttcactcaattcgtaatgattctggaaac
gaaaacattgagagttctcagcatcaattgaaagaaagattggagactcgttatagcagt
gaggatagagtatctgaaatgcgaagaagaaccaaatatagcagtagccaggaggaaggt
ataaatgtgctccaaaattttccggaggtgacaaataatcagcaacctctagtggaagaa
aggatatctaagcaagctggtacgagaaggactactgaacatatttctgaaagttcagaa
attcatgacatagacatcagaaatacatatgtctcgcaaagagaagaccagattagaaac
caagaagtacatgctggcttggtttctggtttgcaatctgaaaggaagcagcaagattat
catattgaacataatcccttgcaaacgacgcaatctgacagaacttctgtgtctgtatct
catactagtgatgcagtaaggtatacagaaattcagagaaaatctgagaagaggctgatt
ggtcaaggaagtactacggctgtgcaatcggacagcaaagtagaaaaaaatggtgctcag
aaagaagactctaggttagatcatgctaactcgaaaaaagatggtcaaacgaccttaggg
ttgcaaagttatcagtcaaagctatctgaagaggcctcaagttcacaatcatctttgatg
gcctcgcgaactaaattacaactggtagatctggtttcagaggaaatgcaaggatctgaa
acgacactgattcctccttcttctcagctggtaagcagaagatcaggacaaagctacaga
actggtggagtttccattcaagaaatttcccatggaacttcagaaagtggttataccaca
gcctttgaacatccaagagcaggagcttctgttaatagtcagtctgctggagaactgatg
ggatttacgtcacatgaagatgctatgggttctgctcatcggttggaacaggcatcagag
aaatatgttggggagtttgtgaaaaaggccaaacatggagttataaatccggagactgag
gagcaaagagctgaaagcaatcaattgaagaggcgggactcaaggcgatcatctggtggt
tcaggagcaaagggaccttcagatgaaatgtgggtaacggattctgctcagggaactcct
catccaggagccacagaaggcaatgcagcagtggggaatgctatttttaaaagaaatggt
aggtcgttgtggaatgttatagctgatattgctcggcttaggtggggctcccgagctgga
agccctgactcgagtgcaaagcccgctggaaggagttcacccaacgaatcagttagcagt
gcaacatggttttctggacgtgagcatgacggaagcagtgatgataacacaaaaggggat
aaagttttgccacaagaagctccttccctacatcaggtggaggttggtcaaacttctcct
agaagccaatctgaatatcccggcactacaaaactgaagcagcgatctgaacggcatgaa
ggtgtggtatcatcgccatcttccacaatattagagggtggctcagtatcgaatcgcatg
tcttccacatctggtaatcaaattgttggtgtggatgaagaagaaggtggaaactttgag
ttccgtcttcctgaaacagctttgacagaggttccaatgaaactgcctagtcggaacctg
ataagatctcctcctattaaggaatcttcagaatctagtcttaccgaggcatccagtgat
caaaattttactgtgggggaaggaagacgctaccctagaatggatgcaggtcaaaatccg
ttattatttccaggtagaaacctacggtctcctgctgtaatggaacctccagtaccccgt
cccagaatggtatccggcagtagcagcttaagagagcaggttgaacaacaacaacctcta
agtgcgaagtcccaggaagaaacaggttctgtatccgcagactctgcgttgatacaaagg
aaacttcagaggaataaacaggttgtgagggatagttttgaggagtgggaagaagcatac
aaggtagaagctgaaagacgaacagttgatgaaatattcatgagggaagcgttagttgaa
gctaagaaggctgctgatacatgggaggtacctgtcggtgctgtgcttgttcatgatgga
aagattattgcccgtggttataacctagtagaggagcttcgtgattcaactgcccatgca
gaaatgatttgcattcgagagggttctaaagcacttcgttcatggaggctcgcggataca
acgctctatgtaacactagaaccgtgcccaatgtgtgcgggagcaatacttcaagcaagg
gtcaacactcttgtatggggtgctcccaataagcttctcggagcagatggaagctggatc
aggctgttccctggaggcgaaggaaatggatcagaggcttcagaaaagccaccacctcca
gttcatccattccatcctaagatgacaatccggcgcggagttcttgaatcagaatgcgct
cagacaatgcagcagtttttccagcttaggagaaaaaagaaagacaagaactcagatcca
cctactcctaccgatcatcatcatcatcatcttcccaaactcctcaacaagatgcatcaa
gtcttaccctttttctgtctgtag

DBGET integrated database retrieval system