KEGG   Arabidopsis thaliana (thale cress): AT1G75780Help
Entry
AT1G75780         CDS       T00041                                 

Gene name
TUB1
Definition
(RefSeq) tubulin beta-1 chain
  KO
K07375  tubulin beta
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04145  Phagosome
Brite
KEGG Orthology (KO) [BR:ath00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    AT1G75780 (TUB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ath03036]
    AT1G75780 (TUB1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ath04812]
    AT1G75780 (TUB1)
   04147 Exosome [BR:ath04147]
    AT1G75780 (TUB1)
Chromosome and associated proteins [BR:ath03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Other tubulins
     AT1G75780 (TUB1)
Cytoskeleton proteins [BR:ath04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulins
    AT1G75780 (TUB1)
Exosome [BR:ath04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AT1G75780 (TUB1)
  Exosomal proteins of colorectal cancer cells
   AT1G75780 (TUB1)
  Exosomal proteins of bladder cancer cells
   AT1G75780 (TUB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tubulin Tubulin_C Tubulin_2 Misat_Tub_SegII Tubulin_3
Motif
Other DBs
NCBI-GeneID: 843911
NCBI-ProteinID: NP_177706
MIPS: AT1G75780.1
TAIR: AT1G75780
Araport: AT1G75780
UniProt: P12411 A0A178WQG2
LinkDB All DBs
Position
1
AA seq 447 aa AA seqDB search
MREILHVQGGQCGNQIGSKFWEVICDEHGVDPTGRYNGDSADLQLERINVYYNEASGGRY
VPRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDAVLDV
VRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLTFSVFPSPKVSDTV
VEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPSFGDLNHLISATMSGVTCS
LRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYISLTVPELTQQMWDAKNM
MCAADPRHGRYLTASAMFRGKMSTKEVDEQILNVQNKNSSYFVEWIPNNVKSSVCDIPPT
GIKMASTFVGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLV
SEYQQYQDATADEEDEYDEEEEQVYES
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgagagaaatcctccacgtccaaggcggccaatgcggtaaccaaatcggttccaaattc
tgggaagttatctgcgacgaacacggcgttgatcccaccggacgttacaacggtgattcc
gccgatcttcagctcgaacgtatcaatgtttattacaatgaagcttctggtggtcgttac
gttcctcgtgctgttctcatggatctcgagcctggtactatggatagtatcagatctggt
ccctacggtcagattttccgtcctgataacttcgtctttggtcaatccggtgccggaaat
aattgggcgaaaggtcattatactgaaggtgctgaacttattgatgctgttctcgatgtt
gttcgtaaggaagctgagaactgtgattgccttcaagggtttcaagtatgtcactctctt
ggaggaggcacgggttcaggaatgggaactctcttgatatcaaagatccgtgaggaatac
ccagacagaatgatgctcacattctctgttttcccatctccaaaggtctcagacacagtc
gttgagccgtacaatgcaactctctcagtccaccaacttgtagagaatgctgatgaatgc
atggtcctcgacaacgaagctctttacgatatctgtttccgcactctcaaactcagcact
cctagctttggagacttgaaccacttgatctccgcaactatgagtggtgtgacttgctct
ttaagattccctggacaactcaactctgaccttaggaaactcgccgtgaaccttatccca
ttccctcgtctacatttcttcatggttggtttcgcccctctcacttcccgtggctctcaa
cagtacatctctctcacagtcccggagctgacacagcaaatgtgggacgctaagaacatg
atgtgtgcagctgatccacgccacggacgttacctcacagcttcagccatgttccgagga
aaaatgagcacaaaggaagtggacgaacagatcctaaatgtccagaacaagaactcatcc
tactttgttgaatggatcccaaacaatgtgaagtccagcgtctgcgacattccaccaact
ggaatcaaaatggcttccacgtttgtcggaaactcgacttcgatccaggaaatgttcagg
agagtaagcgaacagttcacggctatgttcaggcgtaaagctttcttgcattggtacaca
ggagaaggaatggacgagatggagttcactgaagcagagagcaacatgaatgatctggtc
tctgaataccaacaataccaagatgctaccgctgatgaagaagacgaatatgatgaagaa
gaagaacaagtttacgaatcttga

DBGET integrated database retrieval system