KEGG   Arabidopsis thaliana (thale cress): AT2G02010Help
Entry
AT2G02010         CDS       T00041                                 

Gene name
GAD4
Definition
(RefSeq) glutamate decarboxylase 4
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00250  Alanine, aspartate and glutamate metabolism
ath00410  beta-Alanine metabolism
ath00430  Taurine and hypotaurine metabolism
ath00650  Butanoate metabolism
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    AT2G02010 (GAD4)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AT2G02010 (GAD4)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AT2G02010 (GAD4)
   00430 Taurine and hypotaurine metabolism
    AT2G02010 (GAD4)
Enzymes [BR:ath01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     AT2G02010 (GAD4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-GeneID: 814732
NCBI-ProteinID: NP_178310
MIPS: AT2G02010.1
TAIR: AT2G02010
Araport: AT2G02010
UniProt: Q9ZPS3
LinkDB All DBs
Position
2
AA seq 493 aa AA seqDB search
MVLSKTVSESDVSIHSTFASRYVRNSLPRFEMPENSIPKEAAYQIINDELMLDGNPRLNL
ASFVTTWMEPECDKLMMESINKNYVDMDEYPVTTELQNRCVNMIARLFNAPLGDGEAAVG
VGTVGSSEAIMLAGLAFKRQWQNKRKAQGLPYDKPNIVTGANVQVCWEKFARYFEVELKE
VNLREDYYVMDPVKAVEMVDENTICVAAILGSTLTGEFEDVKLLNDLLVEKNKQTGWDTP
IHVDAASGGFIAPFLYPELEWDFRLPLVKSINVSGHKYGLVYAGIGWVVWRTKTDLPDEL
IFHINYLGADQPTFTLNFSKGSSQVIAQYYQLIRLGFEGYRNVMDNCRENMMVLRQGLEK
TGRFKIVSKENGVPLVAFSLKDSSRHNEFEVAHTLRRFGWIVPAYTMPADAQHVTVLRVV
IREDFSRTLAERLVADFEKVLHELDTLPARVHAKMANGKVNGVKKTPEETQREVTAYWKK
LLETKKTNKNTIC
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atggttttgtctaagacagtttccgaatctgatgtctcaatccattcaacttttgcttct
cgttacgtccgcaactctcttccacgattcgaaatgcctgagaactcaatcccaaaagaa
gcagcttaccaaatcatcaacgacgagctaatgctcgatggtaacccaaggctgaaccta
gcttccttcgtgaccacatggatggagccagaatgtgacaagctcatgatggagtccatc
aacaagaactacgtcgacatggacgagtaccctgtcaccactgagcttcagaaccgatgt
gttaacatgatagcacgtctcttcaacgcgccgcttggtgacggtgaagctgccgttggt
gttggcaccgtcggatcgtcggaggcgattatgttggccggtttggcttttaagagacaa
tggcagaataagcgtaaggcccaagggcttccttatgataagcccaatatcgtaaccggt
gctaatgtccaggtttgctgggagaaattcgcaaggtatttcgaagtggagcttaaggaa
gtgaacctaagagaagactattacgtgatggaccctgtaaaggcggtcgaaatggtagac
gaaaacacaatttgtgtcgctgccatcctcggttcaacgttaaccggtgaattcgaagac
gttaagctcctcaacgacctccttgtcgagaaaaacaagcaaaccggatgggacacgcca
atacacgtggacgcagcgagtggtgggtttattgctccgttcttgtatccggagctggag
tgggatttccggctaccgttggttaagagtattaatgtgagtggtcacaaatacggtttg
gtttacgccggtattggttgggttgtatggagaaccaaaaccgatttgcctgatgaactt
atcttccatatcaattatcttggcgctgatcaaccaacctttacactcaacttctccaaa
ggttcaagtcaagtgattgctcagtactaccagctgattcgtcttggattcgagggttat
cgcaatgtgatggataattgtcgggaaaacatgatggtactaagacaaggattagagaaa
acgggacgttttaaaatcgtctccaaagaaaacggtgttccgttagtggcgttttctctc
aaagatagtagccgccacaacgagttcgaggtggcccatacactccgtcgcttcggctgg
atcgttccggcctacacgatgcctgcggatgcgcagcatgtcactgtccttcgagttgtt
atccgagaagatttctctcgaaccttagccgagagattggtagctgatttcgagaaggtt
ctacacgagctcgatacgcttccggcgagggttcacgccaagatggctaatggaaaagtt
aacggtgttaagaagacgccagaggagacgcagagagaagtcacggcctactggaagaag
ttgttggagactaagaagaccaacaagaacacaatttgctaa

DBGET integrated database retrieval system