KEGG   Arabidopsis thaliana (thale cress): AT2G23380Help
Entry
AT2G23380         CDS       T00041                                 

Gene name
CLF
Definition
(RefSeq) SET domain-containing protein
  KO
K11430  histone-lysine N-methyltransferase EZH2 [EC:2.1.1.43]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    AT2G23380 (CLF)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ath03036]
    AT2G23380 (CLF)
Enzymes [BR:ath01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     AT2G23380 (CLF)
Chromosome and associated proteins [BR:ath03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     AT2G23380 (CLF)
   Polycomb group proteins
    PRC2-EZH2 complex
     AT2G23380 (CLF)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET preSET_CXC TCR Macoilin
Motif
Other DBs
NCBI-GeneID: 816870
NCBI-ProteinID: NP_179919
MIPS: AT2G23380.1
TAIR: AT2G23380
Araport: AT2G23380
UniProt: P93831
LinkDB All DBs
Position
2
AA seq 902 aa AA seqDB search
MASEASPSSSATRSEPPKDSPAEERGPASKEVSEVIESLKKKLAADRCISIKKRIDENKK
NLFAITQSFMRSSMERGGSCKDGSDLLVKRQRDSPGMKSGIDESNNNRYVEDGPASSGMV
QGSSVPVKISLRPIKMPDIKRLSPYTTWVFLDRNQRMTEDQSVVGRRRIYYDQTGGEALI
CSDSEEEAIDDEEEKRDFLEPEDYIIRMTLEQLGLSDSVLAELASFLSRSTSEIKARHGV
LMKEKEVSESGDNQAESSLLNKDMEGALDSFDNLFCRRCLVFDCRLHGCSQDLIFPAEKP
APWCPPVDENLTCGANCYKTLLKSGRFPGYGTIEGKTGTSSDGAGTKTTPTKFSSKLNGR
KPKTFPSESASSNEKCALETSDSENGLQQDTNSDKVSSSPKVKGSGRRVGRKRNKNRVAE
RVPRKTQKRQKKTEASDSDSIASGSCSPSDAKHKDNEDATSSSQKHVKSGNSGKSRKNGT
PAEVSNNSVKDDVPVCQSNEVASELDAPGSDESLRKEEFMGETVSRGRLATNKLWRPLEK
SLFDKGVEIFGMNSCLIARNLLSGFKSCWEVFQYMTCSENKASFFGGDGLNPDGSSKFDI
NGNMVNNQVRRRSRFLRRRGKVRRLKYTWKSAAYHSIRKRITEKKDQPCRQFNPCNCKIA
CGKECPCLLNGTCCEKYCGCPKSCKNRFRGCHCAKSQCRSRQCPCFAADRECDPDVCRNC
WVIGGDGSLGVPSQRGDNYECRNMKLLLKQQQRVLLGISDVSGWGAFLKNSVSKHEYLGE
YTGELISHKEADKRGKIYDRENCSFLFNLNDQFVLDAYRKGDKLKFANHSPEPNCYAKVI
MVAGDHRVGIFAKERILAGEELFYDYRYEPDRAPAWAKKPEAPGSKKDENVTPSVGRPKK
LA
NT seq 2709 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcagaagcttcgccttcttcttcggccaccagatcggagccacccaaagactct
ccggcggaggagagaggtccagcttctaaggaagtatcagaagtaatagaatcgctaaag
aagaagcttgcagctgataggtgtatatcaataaagaaaaggattgatgaaaacaagaag
aatttgtttgctattactcaaagttttatgaggtcttctatggaacgaggaggtagctgt
aaagatggcagtgatcttttagttaagaggcaaagagattcgccaggtatgaaaagcgga
atcgatgaaagtaataacaacagatatgtagaagatggacctgccagttcaggaatggtt
caaggatctagtgtccctgtcaaaatttccttacgtcctatcaaaatgcctgatatcaaa
cgtttgtcaccttataccacatgggtttttctggacagaaatcaaagaatgactgaagac
cagtctgtagtgggtcgaaggagaatttattatgatcaaactggcggggaagcgcttatc
tgcagtgatagtgaagaggaggccattgacgacgaagaagaaaaaagagattttttggag
cctgaagattatattattcgcatgacccttgagcaactaggtctttcagactcagtcctg
gcggaactagcaagtttcttgtctagaagtactagtgaaatcaaggcaagacatggagtg
cttatgaaggaaaaagaagtatccgagagtggcgataatcaagcagagagctcccttctc
aacaaagatatggaaggagcattagattctttcgataacctgttctgccgtagatgcctt
gtatttgattgccggcttcatgggtgttcacaggatctcatttttccggctgagaaacca
gctccatggtgtcctcctgtagatgaaaatttaacctgtggtgcaaactgctataaaacg
cttctcaagtctggaagatttccgggatatggcaccattgaaggtaaaactggcacttca
tcagatggtgcaggtactaaaaccacacccacgaagttctccagcaaacttaatgggaga
aaaccaaagaccttcccaagtgaaagtgcatcgtctaatgaaaagtgcgcactagaaaca
agtgactcagagaatggactacagcaggataccaattccgataaagtttcatcatcgcca
aaggtgaaaggtagtgggagacgagtaggtcgtaagaggaacaaaaaccgagttgctgag
cgagttcctcgtaagactcagaagaggcagaagaagacagaagcctcggatagtgattcc
atcgccagtggaagttgttcacccagcgatgcaaaacataaagataatgaagatgctact
tcctcttctcagaagcatgtaaaatctgggaactccgggaagtcaaggaagaatggcact
cctgccgaagtctccaataattctgtgaaggatgacgttcctgtttgccagtcaaatgag
gttgcgtcagagcttgatgcgccgggtagtgatgaaagtctaaggaaagaagagtttatg
ggtgaaactgtatctcgaggaagattggctacaaataagttgtggagaccacttgagaaa
agcctttttgataaaggtgttgagatttttggaatgaatagctgcttgattgctagaaat
cttttgagtggtttcaaatcatgttgggaggtcttccaatacatgacgtgctcggaaaat
aaagcttccttctttggaggtgatggattgaatcctgatggctcttccaagttcgatatc
aatggaaatatggttaataaccaagtgaggagaaggtcaagatttctacgtaggagaggc
aaagtgcggcgcttgaagtatacctggaagtctgctgcatatcattcaattaggaaaaga
attactgagaagaaagaccagccctgccgtcagtttaatccatgtaactgcaaaattgct
tgtgggaaggaatgtccttgtttgctaaacgggacttgctgcgagaagtactgcggttgc
ccaaagagctgcaagaataggtttagaggttgtcattgtgccaaaagtcagtgtcgaagc
cgccagtgtccatgctttgctgcagatcgggaatgtgacccagatgtttgtagaaactgc
tgggtcattggtggggatggttcgcttggggtcccaagccaaagaggcgataattatgag
tgcaggaatatgaaattgctcctgaaacaacaacaaagggttttacttggaatatctgat
gtttctggttggggagctttcttaaagaacagtgtaagtaagcatgaataccttggggaa
tacacaggagagctgatctcacataaagaggcagataaacgcgggaagatatacgatcgc
gagaactgctcttttctcttcaatctaaacgatcagtttgtgctagatgcttacaggaaa
ggagataaactgaaattcgccaaccattctcctgaacctaactgttacgcaaaggtcatc
atggttgctggagatcacagggtggggatcttcgcaaaagagaggatactggctggagaa
gaactattttacgattaccggtatgagccagatcgagctccagcttgggccaaaaaacct
gaagctcctggttctaagaaagacgaaaatgttacaccttctgttggtagacccaagaag
cttgcttag

DBGET integrated database retrieval system