KEGG   Arabidopsis thaliana (thale cress): AT2G28190Help
Entry
AT2G28190         CDS       T00041                                 

Gene name
CSD2
Definition
(RefSeq) copper/zinc superoxide dismutase 2
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:ath00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    AT2G28190 (CSD2)
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     AT2G28190 (CSD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 817365
NCBI-ProteinID: NP_565666
MIPS: AT2G28190.1
TAIR: AT2G28190
Araport: AT2G28190
UniProt: O78310 A0A178VRV1
LinkDB All DBs
Position
2
AA seq 216 aa AA seqDB search
MAATNTILAFSSPSRLLIPPSSNPSTLRSSFRGVSLNNNNLHRLQSVSFAVKAPSKALTV
VSAAKKAVAVLKGTSDVEGVVTLTQDDSGPTTVNVRITGLTPGPHGFHLHEFGDTTNGCI
STGPHFNPNNMTHGAPEDECRHAGDLGNINANADGVAETTIVDNQIPLTGPNSVVGRAFV
VHELKDDLGKGGHELSLTTGNAGGRLACGVIGLTPL
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atggctgccaccaacacaatcctcgcattctcatctccttctcgtcttctcattcctcct
tcctccaatccttcaactctccgttcctctttccgcggcgtctctctcaacaacaacaat
ctccaccgtctccaatctgtttccttcgccgttaaagctccgtcgaaagcgttgacagtt
gtttccgcggcgaagaaggctgttgcagtgcttaaaggtacttctgatgtcgaaggagtt
gttactttgacccaagatgactcaggtcctacaactgtgaatgttcgtatcactggtctc
actccagggcctcatggatttcatctccatgagtttggtgatacaactaatggatgtatc
tcaacaggaccacatttcaaccctaacaacatgacacacggagctccagaagatgagtgc
cgtcatgcgggtgacctgggaaacataaatgccaatgccgatggcgtggcagaaacaaca
atagtggacaatcagattcctctgactggtcctaattctgttgttggaagagcctttgtg
gttcacgagcttaaggatgacctcggaaagggtggccatgagcttagtctgaccactgga
aacgcaggcgggagattggcatgtggtgtgattggcttgacgccgctctaa

DBGET integrated database retrieval system