KEGG   Arabidopsis thaliana (thale cress): AT2G47240
Entry
AT2G47240         CDS       T00041                                 

Symbol
LACS1
Name
(RefSeq) AMP-dependent synthetase and ligase family protein
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00061  Fatty acid biosynthesis
ath00071  Fatty acid degradation
ath01100  Metabolic pathways
ath01212  Fatty acid metabolism
ath04146  Peroxisome
Module
ath_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    AT2G47240 (LACS1)
   00071 Fatty acid degradation
    AT2G47240 (LACS1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    AT2G47240 (LACS1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ath01004]
    AT2G47240 (LACS1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ath04147]
    AT2G47240 (LACS1)
Enzymes [BR:ath01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     AT2G47240 (LACS1)
Lipid biosynthesis proteins [BR:ath01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   AT2G47240 (LACS1)
Exosome [BR:ath04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   AT2G47240 (LACS1)
  Exosomal proteins of breast cancer cells
   AT2G47240 (LACS1)
SSDB
Motif
Pfam: AMP-binding AMP-binding_C Haem_oxygenas_2
Other DBs
NCBI-GeneID: 819337
NCBI-ProteinID: NP_001318440
TAIR: AT2G47240
UniProt: O22898
LinkDB
Position
2:19392497..19397907
AA seq 660 aa
MKSFAAKVEEGVKGIDGKPSVGPVYRNLLSEKGFPPIDSEITTAWDIFSKSVEKFPDNNM
LGWRRIVDEKVGPYMWKTYKEVYEEVLQIGSALRAAGAEPGSRVGIYGVNCPQWIIAMEA
CAAHTLICVPLYDTLGSGAVDYIVEHAEIDFVFVQDTKIKGLLEPDCKCAKRLKAIVSFT
NVSDELSHKASEIGVKTYSWIDFLHMGREKPEDTNPPKAFNICTIMYTSGTSGDPKGVVL
THQAVATFVVGMDLYMDQFEDKMTHDDVYLSFLPLAHILDRMNEEYFFRKGASVGYYHGN
LNVLRDDIQELKPTYLAGVPRVFERIHEGIQKALQELNPRRRFIFNALYKHKLAWLNRGY
SHSKASPMADFIAFRKIRDKLGGRIRLLVSGGAPLSPEIEEFLRVTCCCFVVQGYGLTET
LGGTALGFPDEMCMLGTVGIPAVYNEIRLEEVSEMGYDPLGENPAGEICIRGQCMFSGYY
KNPELTEEVMKDGWFHTGDIGEILPNGVLKIIDRKKNLIKLSQGEYVALEHLENIFGQNS
VVQDIWVYGDSFKSMLVAVVVPNPETVNRWAKDLGFTKPFEELCSFPELKEHIISELKST
AEKNKLRKFEYIKAVTVETKPFDVERDLVTATLKNRRNNLLKYYQVQIDEMYRKLASKKI
NT seq 1983 nt   +upstreamnt  +downstreamnt
atgaagtcttttgcggctaaggtagaagagggagttaaaggaatagacggaaagccgtcg
gtaggtccggtgtaccggaatcttctgtcggaaaaaggttttcctccgattgattctgag
atcaccactgcttgggacattttcagtaaatcagtggagaaattccctgacaataatatg
cttggatggcgtcgaattgttgatgagaaggttggaccatatatgtggaaaacgtacaag
gaagtatacgaagaagttttgcagattggctctgcactacgagccgccggagctgaacct
gggagtcgagtggggatctacggtgttaattgtcctcagtggatcatagcaatggaggct
tgtgcagctcacactctaatctgtgtacctctatatgatacattgggttcaggagcagtc
gattacattgtagagcatgcggaaatcgactttgtgtttgtccaagacaccaaaattaaa
ggacttcttgagccagattgcaaatgtgctaaacggctaaaagctatagtttccttcact
aacgtgagcgacgagcttagccacaaggcttcagaaattggagtcaaaacatactcctgg
atcgattttctccatatgggacgtgagaaaccggaagacacgaacccgcctaaggcgttt
aacatatgcaccataatgtacaccagcggcacaagcggtgatcctaaaggtgtggttttg
actcaccaagcggtcgcgacttttgttgttgggatggatctctatatggaccagtttgaa
gataagatgacacatgatgatgtgtatctctccttcttgcccttggctcatattcttgac
cgtatgaacgaggaatacttctttcgcaaaggcgcttccgtcggctattaccatggaaat
ttgaacgtgttacgtgacgatattcaagaactgaaaccgacttatctagctggagtacca
agagtgtttgagagaatccatgaggggattcaaaaggctcttcaagaacttaacccaaga
aggagattcatcttcaatgctctctacaaacacaagcttgcgtggttgaatcgtgggtac
tctcatagtaaagcttcacccatggctgatttcattgctttcagaaagattagagacaaa
ttgggaggtcgcatccggttgctagtatctggaggagcacctttgagccctgagattgaa
gagtttttgagagttacttgttgttgctttgtcgttcaaggctacggtctaacggagaca
cttggaggaacggctttgggtttcccggacgagatgtgtatgctagggacagtcggtatt
ccagcggtttacaacgagatacggcttgaagaggtgtctgaaatgggctatgacccgctc
ggagaaaatccggcaggagagatctgtataagaggacaatgtatgttttcagggtattac
aagaaccctgaactcactgaagaagtcatgaaagatggatggttccacacaggagatata
ggtgagattcttccaaacggagtactcaagatcatcgatcgtaaaaagaatctgatcaaa
ctttctcaaggagaatatgttgctctcgagcatttggaaaacatcttcgggcaaaactct
gttgtccaagatatatgggtttatggagacagcttcaaatctatgcttgtcgcggtggtt
gttcccaacccagaaaccgtcaacaggtgggctaaagatctcggttttactaaaccattc
gaagaactctgttctttcccggaactaaaagaacacatcatttcagaactgaagtccacg
gcagaaaagaacaagctaagaaagtttgagtacatcaaagcggtgacagtggagacaaaa
cctttcgacgtagagagagacttagtgactgcgacgctcaagaatcggaggaacaatctt
ctcaaatattatcaggtgcaaatcgacgaaatgtaccgcaaattggcctcaaagaaaatc
tga

DBGET integrated database retrieval system