KEGG   Arabidopsis thaliana (thale cress): AT3G12120Help
Entry
AT3G12120         CDS       T00041                                 

Gene name
FAD2
Definition
(RefSeq) fatty acid desaturase 2
  KO
K10256  omega-6 fatty acid desaturase / acyl-lipid omega-6 desaturase (Delta-12 desaturase) [EC:1.14.19.6 1.14.19.22]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath01040  Biosynthesis of unsaturated fatty acids
ath01100  Metabolic pathways
ath01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09103 Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    AT3G12120 (FAD2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ath01004]
    AT3G12120 (FAD2)
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.6  acyl-CoA (9+3)-desaturase
     AT3G12120 (FAD2)
    1.14.19.22  acyl-lipid omega-6 desaturase (cytochrome b5)
     AT3G12120 (FAD2)
Lipid biosynthesis proteins [BR:ath01004]
 Desaturase
  Omega
   AT3G12120 (FAD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FA_desaturase DUF3474
Motif
Other DBs
NCBI-GeneID: 820387
NCBI-ProteinID: NP_001319529
MIPS: AT3G12120.1
TAIR: AT3G12120
Araport: AT3G12120
UniProt: P46313 A0A178VIK7
LinkDB All DBs
Position
3
AA seq 383 aa AA seqDB search
MGAGGRMPVPTSSKKSETDTTKRVPCEKPPFSVGDLKKAIPPHCFKRSIPRSFSYLISDI
IIASCFYYVATNYFSLLPQPLSYLAWPLYWACQGCVLTGIWVIAHECGHHAFSDYQWLDD
TVGLIFHSFLLVPYFSWKYSHRRHHSNTGSLERDEVFVPKQKSAIKWYGKYLNNPLGRIM
MLTVQFVLGWPLYLAFNVSGRPYDGFACHFFPNAPIYNDRERLQIYLSDAGILAVCFGLY
RYAAAQGMASMICLYGVPLLIVNAFLVLITYLQHTHPSLPHYDSSEWDWLRGALATVDRD
YGILNKVFHNITDTHVAHHLFSTMPHYNAMEATKAIKPILGDYYQFDGTPWYVAMYREAK
ECIYVEPDREGDKKGVYWYNNKL
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgggtgcaggtggaagaatgccggttcctacttcttccaagaaatcggaaaccgacacc
acaaagcgtgtgccgtgcgagaaaccgcctttctcggtgggagatctgaagaaagcaatc
ccgccgcattgtttcaaacgctcaatccctcgctctttctcctaccttatcagtgacatc
attatagcctcatgcttctactacgtcgccaccaattacttctctctcctccctcagcct
ctctcttacttggcttggccactctattgggcctgtcaaggctgtgtcctaactggtatc
tgggtcatagcccacgaatgcggtcaccacgcattcagcgactaccaatggctggatgac
acagttggtcttatcttccattccttcctcctcgtcccttacttctcctggaagtatagt
catcgccgtcaccattccaacactggatccctcgaaagagatgaagtatttgtcccaaag
cagaaatcagcaatcaagtggtacgggaaatacctcaacaaccctcttggacgcatcatg
atgttaaccgtccagtttgtcctcgggtggcccttgtacttagcctttaacgtctctggc
agaccgtatgacgggttcgcttgccatttcttccccaacgctcccatctacaatgaccga
gaacgcctccagatatacctctctgatgcgggtattctagccgtctgttttggtctttac
cgttacgctgctgcacaagggatggcctcgatgatctgcctctacggagtaccgcttctg
atagtgaatgcgttcctcgtcttgatcacttacttgcagcacactcatccctcgttgcct
cactacgattcatcagagtgggactggctcaggggagctttggctaccgtagacagagac
tacggaatcttgaacaaggtgttccacaacattacagacacacacgtggctcatcacctg
ttctcgacaatgccgcattataacgcaatggaagctacaaaggcgataaagccaattctg
ggagactattaccagttcgatggaacaccgtggtatgtagcgatgtatagggaggcaaag
gagtgtatctatgtagaaccggacagggaaggtgacaagaaaggtgtgtactggtacaac
aataagttatga

DBGET integrated database retrieval system