KEGG   Arabidopsis thaliana (thale cress): AT3G17760Help
Entry
AT3G17760         CDS       T00041                                 

Gene name
GAD5
Definition
(RefSeq) glutamate decarboxylase 5
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00250  Alanine, aspartate and glutamate metabolism
ath00410  beta-Alanine metabolism
ath00430  Taurine and hypotaurine metabolism
ath00650  Butanoate metabolism
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
Module
ath_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    AT3G17760 (GAD5)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AT3G17760 (GAD5)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AT3G17760 (GAD5)
   00430 Taurine and hypotaurine metabolism
    AT3G17760 (GAD5)
Enzymes [BR:ath01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     AT3G17760 (GAD5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 DUF4255
Motif
Other DBs
NCBI-GeneID: 821044
NCBI-ProteinID: NP_001154621
MIPS: AT3G17760.1
TAIR: AT3G17760
Araport: AT3G17760
UniProt: Q9LSH2 A0A178VFR2
LinkDB All DBs
Position
3
AA seq 494 aa AA seqDB search
MVLATNSDSDEHLHSTFASRYVRAVVPRFKMPDHCMPKDAAYQVINDELMLDGNPRLNLA
SFVTTWMEPECDKLIMDSVNKNYVDMDEYPVTTELQNRCVNMIANLFHAPVGEDEAAIGC
GTVGSSEAIMLAGLAFKRKWQHRRKAQGLPIDKPNIVTGANVQVCWEKFARYFEVELKEV
KLSEDYYVMDPAKAVEMVDENTICVAAILGSTLTGEFEDVKQLNDLLAEKNAETGWETPI
HVDAASGGFIAPFLYPDLEWDFRLPWVKSINVSGHKYGLVYAGVGWVVWRTKDDLPEELV
FHINYLGADQPTFTLNFSKGSSQIIAQYYQFIRLGFEGYKNIMENCMDNARRLREGIEMT
GKFNIVSKDIGVPLVAFSLKDSSKHTVFEIAESLRKFGWIIPAYTMPADAQHIAVLRVVI
REDFSRGLADRLITHIIQVLKEIEGLPSRIAHLAAAAAVSGDDEEVKVKTAKMSLEDITK
YWKRLVEHKRNIVC
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atggtactcgcaaccaactctgactccgacgagcatttgcattccacttttgcttctaga
tatgtccgtgctgttgttcccaggttcaagatgcctgaccattgcatgcccaaagatgct
gcttatcaagtgatcaatgatgagttgatgcttgatggtaatcccaggcttaacctagcc
tcctttgtcaccacttggatggaacctgagtgtgacaaactcatcatggattctgtcaat
aagaactatgttgatatggatgaatatcctgtcaccactgagctccagaaccggtgtgta
aatatgatagcaaacttgttccatgctcccgttggagaagacgaggctgctattgggtgt
ggaactgttggttcatctgaggctataatgcttgctggtttggctttcaaaaggaaatgg
caacataggagaaaagctcagggtctacctattgataagcctaacattgtcactggagcc
aatgttcaggtgtgctgggagaagtttgcaaggtactttgaggtagagctcaaagaggtg
aaactaagtgaagactactatgttatggatccagctaaagctgtagagatggtggatgag
aataccatctgtgttgcagcaattctaggatccacacttactggagagtttgaggacgtt
aagcaattgaacgatctcttagctgagaaaaacgcagagacaggatgggaaactcctatt
catgttgatgcagccagtggaggattcattgctcctttcctctaccctgatcttgaatgg
gactttaggcttccatgggtgaagagtattaacgtcagtggtcacaagtatggacttgtg
tatgcaggagttggttgggttgtctggagaacaaaagatgatttgccagaggaacttgtc
ttccacatcaactacttgggagctgatcaacccactttcactctcaacttctcaaaaggg
tcgagccaaatcattgctcagtactatcagtttatccgactaggctttgagggatacaag
aacataatggaaaactgcatggataacgcaaggaggctaagagaaggaatagagatgaca
gggaagttcaacattgtgtccaaagatattggcgtgccactagtggcattctctctcaaa
gacagtagcaagcacacggtgtttgagatcgcagagtctttgagaaaattcgggtggatc
ataccggcttacactatgcctgcagatgcacagcacattgctgtgctcagagttgtgata
agagaagactttagccgaggccttgcagatagactcatcacacatatcattcaggtgctg
aaagagattgaagggcttcctagcaggattgcacatcttgctgcggctgcagcggttagt
ggtgatgatgaagaagttaaagtgaagactgccaagatgtccttggaggatatcactaag
tattggaaacgccttgtggaacacaagagaaatattgtctgctaa

DBGET integrated database retrieval system