KEGG   Arabidopsis thaliana (thale cress): AT3G19420Help
Entry
AT3G19420         CDS       T00041                                 

Gene name
PEN2
Definition
(RefSeq) PTEN 2
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00562  Inositol phosphate metabolism
ath01100  Metabolic pathways
ath04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    AT3G19420 (PEN2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    AT3G19420 (PEN2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ath01009]
    AT3G19420 (PEN2)
Enzymes [BR:ath01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     AT3G19420 (PEN2)
    3.1.3.48  protein-tyrosine-phosphatase
     AT3G19420 (PEN2)
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     AT3G19420 (PEN2)
Protein phosphatases and associated proteins [BR:ath01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    AT3G19420 (PEN2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DSPc Y_phosphatase Y_phosphatase3 CDKN3
Motif
Other DBs
NCBI-GeneID: 821476
NCBI-ProteinID: NP_188573
MIPS: AT3G19420.1
TAIR: AT3G19420
Araport: AT3G19420
UniProt: Q9LT75 A0A178V9M6
LinkDB All DBs
Position
3
AA seq 611 aa AA seqDB search
MSSESPNLPAAAGTVPDNHPPPPPVVTAAEAGSDDSPKGVASKLSAAGISNWAKNLKVPQ
PFASTQNDSGVENTEKSAFAKFTSGLGIRLSPKSPQTNDTTTEGTSSATESSFIGTITKG
LVDTSKNAVKAVQVKARHAVSQNKRRYQEGGFDLDLTYITENIIAMGFPAGDMSSGFFGY
VEGFYRNQMEEVINFLETQHKGKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIHLV
TSFCQSAYSWLKEDIENVVVVHCKAGMARTGLMICSLLLYLKFFPTAEECMDFYNQKRCV
DGKGLVLPSQIRYVKYFERILTYFNGENQPGRRCMLRGFRLHRCPYWIRPSITISDHNGV
LFTTKKHPRTKDLSPEDFWFSAPKKGVMVFALPGEPGLTELAGDFKIQFHDRQGDFYCWL
NTTMMENRVILKTSELDGFDKRKLPSPGFMVEVVLADINATIPTNPSSETASKTPEETSA
ANSSPVDGSASVPGPDKETENPDKDDVFSDNEGDSTGPTKTTSSASSQTPEAKKSADETA
VLTKATEKVSISGNKGSSQPVQGVTVSKGEATEKPSGAGVNASSSSESEFKVMAADASVF
SFGDEDDFESD
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtctgagtcaccgaatttgcctgctgctgcgggaacagtaccagataatcatcct
cctcctcctcctgttgttactgctgcagaagctggaagcgatgattcacctaaaggagta
gcatcaaaactatctgctgctgggatttcaaattgggccaaaaacttgaaagttccacag
ccttttgcttccacacaaaacgactctggtgtcgaaaacaccgagaagtctgcgtttgca
aagtttacaagcgggttagggattcgtttatctccgaaatctcctcaaacgaatgacact
accacagaaggaacttcgagtgctacagaatctagttttattgggactattacgaaaggt
ttggtagatacatcaaagaatgctgtcaaggcagtacaagtcaaggctcgacatgctgta
tcacagaacaaacgaagatatcaggaaggaggatttgatttggatttgacgtacataaca
gagaacatcattgcaatggggtttcctgctggtgatatgagttctggcttttttggatat
gttgagggtttctaccgtaaccaaatggaagaagttattaactttcttgaaactcaacac
aagggaaaatacaaggtttacaatctttgttcagagagattgtatgatgtatcattattt
gaagggaaggtggccagtttcccatttgatgatcataattgcccgccaatccatttggtc
acctcattctgccaaagtgcatattcatggttaaaggaggacattgagaacgttgtggtt
gttcactgtaaggctggcatggcaaggacagggcttatgatatgcagtcttctgttgtat
ctgaagttctttcccactgccgaagagtgtatggacttctacaaccagaaacgatgtgtg
gatggaaaaggacttgtgctacccagccaaattagatatgtgaaatactttgaaagaatt
ttgacctacttcaacggtgaaaaccaaccaggccgtaggtgtatgcttaggggattccgg
ctccataggtgtccctattggattaggccatccatcactatttcagatcacaatggtgtt
ctctttaccacgaaaaagcatcctcggaccaaggatctctcgcctgaagacttttggttc
agtgccccaaagaaaggggttatggtctttgccttacctggagagccaggtctaacagaa
ttggctggggacttcaaaatccaatttcatgaccggcaaggagatttctactgctggtta
aacacgacaatgatggaaaatagagtgatcctaaaaaccagtgagcttgatgggtttgac
aagaggaagctaccatcgcctggatttatggttgaagttgttctagctgatataaatgca
acaatccctacgaaccctagttctgaaacagcatccaaaacaccggaagaaacttcagca
gctaattcgtcccctgtagacggctctgcatcggttccaggacccgataaagaaacagag
aatcctgataaggacgatgtgttctctgataacgaaggagactcaactggcccgaccaaa
accacatcatcggcttcttctcaaaccccagaagccaaaaagagcgcagatgaaaccgct
gttctgactaaagcgacagagaaagtgtctatttctggaaacaaaggatcatcacagccg
gtgcaaggagtaactgtgagcaagggtgaagcaacagaaaaaccctctggggctggggtc
aatgcttcttcaagctcagagagtgagttcaaggttatggcggctgatgcatctgtgttc
tcatttggagatgaagacgactttgaaagcgattga

DBGET integrated database retrieval system