KEGG   Arabidopsis thaliana (thale cress): AT3G21230Help
Entry
AT3G21230         CDS       T00041                                 

Gene name
4CL5
Definition
(RefSeq) 4-coumarate:CoA ligase 5
  KO
K01904  4-coumarate--CoA ligase [EC:6.2.1.12]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00130  Ubiquinone and other terpenoid-quinone biosynthesis
ath00940  Phenylpropanoid biosynthesis
ath00999  Biosynthesis of secondary metabolites - unclassified
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
Module
ath_M00039  Monolignol biosynthesis, phenylalanine/tyrosine => monolignol
ath_M00137  Flavanone biosynthesis, phenylalanine => naringenin
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    AT3G21230 (4CL5)
  09110 Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    AT3G21230 (4CL5)
   00999 Biosynthesis of secondary metabolites - unclassified
    AT3G21230 (4CL5)
Enzymes [BR:ath01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.12  4-coumarate---CoA ligase
     AT3G21230 (4CL5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-GeneID: 821677
NCBI-ProteinID: NP_188760
MIPS: AT3G21230.1
TAIR: AT3G21230
Araport: AT3G21230
UniProt: Q9LU36
LinkDB All DBs
Position
3
AA seq 570 aa AA seqDB search
MVLQQQTHFLTKKIDQEDEEEEPSHDFIFRSKLPDIFIPNHLPLTDYVFQRFSGDGDGDS
STTCIIDGATGRILTYADVQTNMRRIAAGIHRLGIRHGDVVMLLLPNSPEFALSFLAVAY
LGAVSTTANPFYTQPEIAKQAKASAAKMIITKKCLVDKLTNLKNDGVLIVCLDDDGDNGV
VSSSDDGCVSFTELTQADETELLKPKISPEDTVAMPYSSGTTGLPKGVMITHKGLVTSIA
QKVDGENPNLNFTANDVILCFLPMFHIYALDALMLSAMRTGAALLIVPRFELNLVMELIQ
RYKVTVVPVAPPVVLAFIKSPETERYDLSSVRIMLSGAATLKKELEDAVRLKFPNAIFGQ
GYGMTESGTVAKSLAFAKNPFKTKSGACGTVIRNAEMKVVDTETGISLPRNKSGEICVRG
HQLMKGYLNDPEATARTIDKDGWLHTGDIGFVDDDDEIFIVDRLKELIKFKGYQVAPAEL
EALLISHPSIDDAAVVAMKDEVADEVPVAFVARSQGSQLTEDDVKSYVNKQVVHYKRIKM
VFFIEVIPKAVSGKILRKDLRAKLETMCSK
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atggtgctccaacaacaaacgcattttctcacaaagaagatagatcaagaagacgaagaa
gaagaaccttctcatgatttcattttccgatctaagcttcctgatatcttcatccctaac
cacctccctctcaccgattacgtcttccaaaggttctccggcgatggcgacggagattcc
tcaacaacctgtatcatcgacggtgccactggccgtattttgacctacgccgatgtacaa
accaacatgcggaggatagctgccggaatccaccggctcgggatccgccacggagacgtc
gtaatgcttctcctcccgaactcgccggagtttgctctgtcttttcttgccgttgcttac
cttggagccgtttccactaccgcgaatccgttctacactcagccggagatcgctaaacag
gctaaagcctccgccgcgaagatgatcatcacgaagaaatgtttagtcgataaactaaca
aacctcaaaaacgacggcgttttgatcgtttgcctagacgatgacggtgacaacggcgtt
gtttcgtcgagtgatgatggttgcgtgagtttcacggaactgactcaagcggacgaaaca
gaacttctaaaacctaaaatatcgccggaagacacggtggcgatgccgtactcttccgga
acaacgggacttccaaagggagtgatgattactcacaagggtttagttacaagcatcgct
cagaaagtcgacggagaaaaccctaaccttaacttcacggccaatgacgtcatcctctgt
tttctcccaatgtttcacatttacgctctcgacgcgttgatgctttcggcgatgagaacc
ggtgcagcgttactgatcgtgccgaggttcgagttgaatctggtgatggagctgattcaa
aggtacaaagtcacggttgtgccggtggctcctccggtggttttagcattcattaaatcc
cctgagacggagagatacgacttgagctcggtgagaattatgctatcaggtgcagctaca
ctaaagaaggagcttgaagacgccgtgcgactcaagtttcctaatgccatttttggtcag
ggttatggaatgaccgagtccggaacggtagctaagtcattagcgtttgcaaagaaccca
tttaaaaccaagtccggtgcatgtgggactgtgatcagaaacgccgagatgaaagtggtc
gataccgaaaccggaatctccttgccgcgcaacaaatctggcgagatctgcgtccgaggt
catcagctcatgaaaggttatttgaatgatccggaagctactgcacgaaccatagacaaa
gacgggtggttacatacaggagatattgggtttgtggatgatgatgatgagatcttcatt
gttgatcggttgaaggaactgatcaaattcaaaggctaccaagtggctccagctgagctt
gaagcattgcttatttctcatccttctatcgatgatgccgcagttgttgcaatgaaggat
gaagtagctgatgaggttccagtagcatttgtagcaagatctcaagggtctcagttaact
gaagatgatgtcaagagttacgtaaacaaacaggtggttcactacaagcggattaagatg
gtgtttttcatagaagttataccaaaagcagtttcgggcaagattctgaggaaggatctg
cgagctaaattggaaaccatgtgctctaaatag

DBGET integrated database retrieval system